SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000024718 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000024718
Domain Number 1 Region: 188-331
Classification Level Classification E-value
Superfamily PH domain-like 2.67e-37
Family Third domain of FERM 0.00042
Further Details:      
 
Domain Number 2 Region: 87-187
Classification Level Classification E-value
Superfamily Second domain of FERM 1.57e-27
Family Second domain of FERM 0.00013
Further Details:      
 
Domain Number 3 Region: 6-87
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.45e-21
Family First domain of FERM 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000024718   Gene: ENSGACG00000018697   Transcript: ENSGACT00000024767
Sequence length 332
Comment pep:known_by_projection group:BROADS1:groupVII:553269:557591:1 gene:ENSGACG00000018697 transcript:ENSGACT00000024767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTKLRLRVVFLDDSERTFEVEQKVLGGDFFNKVCGHLKLLEKEYFGLEFRHQGGNYVWLE
LLKPLAKQIKCEFPKGLARFIVKFFPPDPGQLKRGLTRYLFALQIKQDLSNGSLTCNDNS
AALLVSHILQSELGDYDDEMDSQHLEMKQYVPNQEYLDHKITKFHRKHRGASPGESDIQL
LEVARKLDMYGIRPHRAHDGEGMRINLSVTHSGVLVFQGNTKINTFSWAKIRKLSFKRKH
FLIKLHDKVGASCKDTLEFSMASRDVCKCFWKTCVEYHAFFRLSEEPETAPRTLLSCRGS
SFRYSLCVSGRTQKQLLECMGSGEKKPSNFER
Download sequence
Identical sequences G3Q4B4
ENSGACP00000024718 69293.ENSGACP00000024718 ENSGACP00000024718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]