SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000024720 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000024720
Domain Number 1 Region: 157-257
Classification Level Classification E-value
Superfamily PH domain-like 2.11e-30
Family Phosphotyrosine-binding domain (PTB) 0.00000919
Further Details:      
 
Domain Number 2 Region: 32-129
Classification Level Classification E-value
Superfamily PH domain-like 2.01e-23
Family Phosphotyrosine-binding domain (PTB) 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000024720   Gene: ENSGACG00000018703   Transcript: ENSGACT00000024769
Sequence length 1058
Comment pep:novel group:BROADS1:groupVII:583953:587561:-1 gene:ENSGACG00000018703 transcript:ENSGACT00000024769 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRASPSSLSQVPTAEELYAAASVASTSDAVDDVRKCGYLRKQKHGHKRFFVLRAASRLGP
SRLEYYDSEKKFRSTLRRRVIYLYQCFTVNKRADSKNKHLIALYTKDEYFAIVAENEQEQ
EDWYVAVSELMSEGKKGHVDSDDLDDGYGTVTPGTVFKEVWQVNVKPKGLGQTKNLTGVH
RLCLSTKTVHLVKLNSETPCVNLQLMNIRRCGHSESFFFIEVGRSSSIGPGEIWMQVDDS
VVAQSMHETILETMKALKAFAEFRPRSKSQSSGSNPMPFITTRRHLGNLPPSQTGLQRRS
RTESVVGTPPSSKSSGASGYRFRTSSEGEGTMNRFRSITGSLVHLNTTRAHHGRQEGGGG
AVATGNAGTSTGGSRYVRAIAGVASTCHARSASLPVSHFPSTTSPVSVSSSSGHGSVSDT
LTRPSSASICGSPSDGGFNSSDEYGSSPGDFRYFRVRSNTPDSLGNTPPIREENCLNDYM
AMGWNREVFGASGGDTPRDESTSTTEDERYPPSSSSLRRRAHSFSRTKMTQTNLSLEEGS
DAALPFGSGLLRGGPSSSSSSLRSDYSSCSEHSQQSRPSTLPRTEAGGERPLLSSSAKED
SGYMPMLHSPALGPRSAHHQQLQSQSSTDSHGYMMMLPGRGGSSSPSPSPHGSSGATDSI
AERPENGEYMDMSCSGGRKPSNEGSSGYLTPGTPEGPPKSYSPYFSLPRSYKAPTRDGDE
REYADYVPMSSPAKPVYSSVAMASVLTPEKKGGGGSGSNASAPSHPPPPYGAHHTTAAVA
DQRAARPNRLPLGRRSFHGPQRVGDASVPATVPAAVGSSEGPSSPGEYINIEFGDHYPHQ
QQPPAYPLSGQDDAPSLDRRHSPHQDYMSVDVAADQRDGAGCLGKNQSPRPSLVAPWNPP
SYIRPLASNPGALASPGVSAGGHWRSMGDDYTDMTFNPSRGERTQTSPTAVLQHLCVMEG
RYGHVPPASPAPASPPPTQQPEPKVVRADPQGRRRHSSETFSSTSSTTSTPSGGWASSAS
FDSTWMSMEGASRMCWNISVCYQNGLYYIALDLRDDGC
Download sequence
Identical sequences G3Q4B6
ENSGACP00000024720 69293.ENSGACP00000024720 ENSGACP00000024720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]