SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000024737 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000024737
Domain Number 1 Region: 956-1226
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.55e-69
Family Tandem AAA-ATPase domain 0.000021
Further Details:      
 
Domain Number 2 Region: 704-954
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.39e-55
Family Tandem AAA-ATPase domain 0.0000606
Further Details:      
 
Domain Number 3 Region: 459-506,533-579
Classification Level Classification E-value
Superfamily Chromo domain-like 8.51e-17
Family Chromo domain 0.016
Further Details:      
 
Domain Number 4 Region: 599-670
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0000000000145
Family Chromo domain 0.0062
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000024737
Domain Number - Region: 159-199
Classification Level Classification E-value
Superfamily HMG-box 0.000916
Family HMG-box 0.0058
Further Details:      
 
Domain Number - Region: 344-385
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00354
Family PHD domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000024737   Gene: ENSGACG00000018705   Transcript: ENSGACT00000024786
Sequence length 1941
Comment pep:known_by_projection scaffold:BROADS1:scaffold_208:60551:76320:1 gene:ENSGACG00000018705 transcript:ENSGACT00000024786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSPCNADFADDEDGEVSENETPKVKKKKKAKKSKESKSSKRRSRREVRRRMLSSLELPVS
SPEPMDLVGAEEAEGQRSDSEGSDYTPGRKKKRRGGSGKEKKRSSSGAERSSSRKKEPEP
EEDDDDDDDDSSEPKSSSQLLDDWGMEDIDHVFNEEDYRSLTNYKAFSQFVRPLIAAKNP
KIAVSKMMMVLGAKWREFSTNNPLRGAAAANAALATANVPAAVDTMVAEVAPVAVAPPPP
PPPPPTPVEAQQPPPPLRKAKTKEGKGPNARKKSKPTPKQLEKKNSAKTKKVAPLKIKLG
GFSSKRKRSSSEEDEPEVDSDFEDGSITGFSFSEGYNNRSIRTKKKPSKSNPKKKKAEEG
DGYETDPQDYCEVCQQGGEIILCDITYQGHTHTLWTPTREGFFGASLALRTEKEGIQWEA
REEASEGEEDIGDTGDMEEDDLHMEFCRVCKDGGELLCCDSCPSSYHIHCLNPPLPEIPN
GEWICPRCTCPSMKGKVQKILTWRWGEAPPPTPVPRPLDLAADAPDPKPLAGRPDREFFA
KWSNMSYWHCSWVTELQLELHCQVMFRNYQRKNDMDDPPPIDFAEGEEDKSVKRKAKDPM
YAQLDEKYLRFGIKFEWLMMHRIINHSVDRKNNVHYLIKWRELAYDQATWEADDMDIPDY
DTYKVQYWNHRELMMGDEGKPGKKIKVKGRVKRPDRPPENPVVDPTIKFERQPDYLDSTG
GTLHPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAP
LSTIINWEREFEMWAPDMYVVTYVGDKDSRAVIRENEFSFEDNAIRGGKKASRMKKDSSI
KFHVLLTSYELITIDMAILGSIDWACLVVDEAHRLKNNQSKFFRVLNNYPLQHKLLLTGT
PLQNNLEELFHLLNFLTPERFSKLEIFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVF
KHMPSKTELIVRVELSPLQKKYYKFILTKNFEALNTKGGGNQVSLLNVVMDLKKCCNHPY
LFPTAAIEAPKMPNGMYDGNSLTKAAGKLTLLQTMMRKLKAGGHRVLIFSQMTKMLDLLE
DFLENEGYKYERIDGGITGGMRQEAIDRFNAPGAPQFAFLLSTRAGGLGINLATADTVII
YDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTKASVEERITQVAKKKMMLTHLVVRPGL
GSKTGSMSKQELDDILKFGTEQLFKDEFDGGLGEFNKEEDSSVIHYDEKAIDRLLDRNQD
ATEDKELQSMNEYLSSFKVAQYVVKDEEEEEEEVQREIIKQEESVDPDYWEKLLRHHYEQ
QQEDLARNLGKGKRIRKQVNYNDGSQEDRGKNGGNLCFLLLLSFQNECNEVSDWQDDQSD
GQSDYSVASEEGDEDFDERTEANSRRPSRKGLRNDKDKPLPPLLARVGGNIEVLGFNSRQ
RKAFLNAVMRYGMPPQDAFTTQWLVRDLRGKSEKEFKAYVSLFMRHLCEPGADGAETFAD
GVPREGLSRQHVLTRIGVMSLIRKKVQEFEHVNGQWSMPWMAELEESKKAAAAGQPDSPG
KTPSTGTPADTQPNTPAPGKAPPPPRSSPRTHPREARRKRPNEVFLGSLSTGDDSKMEET
AKDPEEVKKEGEAEKNGKEEEEQKSPEPESKKNGEEPMETDKPGNGEADKEKEAEEGTKS
SEGGEDTKSTPEAKAEGSEVKPEDAEVKVIAAASSEEKKKAKSRFMFNIADGGFTELHSL
WQNEERAATVTKKTNEIWHRRHDYWLLAGIIQHGYARWQDIQNDVKFAILNEPFKGEMNR
GNFLEIKNKFLARRFKLLEQALVIEEQLRRAAYLNMSEDPSHPSMALNTRFSEVECLAES
HQHLSKESMSGNKPANAVLHKVLKQLEELLSDMKADVTRLPATIARIPPVAVRLQMSERN
ILSRLASRGPETQTQSQTQQV
Download sequence
Identical sequences G3Q4D3
ENSGACP00000024737 ENSGACP00000024737 69293.ENSGACP00000024737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]