SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000024817 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000024817
Domain Number 1 Region: 4-113
Classification Level Classification E-value
Superfamily PH domain-like 3.48e-26
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000024817   Gene: ENSGACG00000018772   Transcript: ENSGACT00000024866
Sequence length 706
Comment pep:novel group:BROADS1:groupVII:966526:974176:-1 gene:ENSGACG00000018772 transcript:ENSGACT00000024866 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGPGEVVCEGWLRKSPPEKKLRRHAWKRRWFVLRSGRLSGEPDVLQYFKSQQTRRPIRT
INLSLCEQVDAGLSFTKKELESSFVFHLRTEERTWYLVAESEEDMNRWVSSISLLWGFNP
TEDGASGEGGGGGSKTGPERHSVSGSSATAMAAATRSVPDPYDLPGAGSPTHGGDAEENY
MWLSHCQSHIGITNTKDFATVAFWLGHKTPLKVNHPDPKSEASFSFHHLAGKRLQQPPSS
GTPPSGQSPDAGVTSDLQRPPGRLRCHPSPHPRKHSLDFRLRPVAIPLSAAAPCAHPYAA
GGYQVPRRESKTQSAPPSPLPRGLPHCFPELERRDGCLEGGGLPRSNTVTSPASFCVFFG
CFQSISERLTTFLSNVFLFAPGGDAVYAPRSLSHRASMFDFSERFNSYFLNKGLVPLGSV
CSEDDDVDENYVPMSAAATEPPVAPRVPPPPPSDPCVHLREANYVPMTPLAPPPPAHPTP
ATGDPPSLGKRVPPPAHAGFRSHPLTPAAPLTPPPLRRAAAESPGGGGGEATPPPIHRDL
KPQRRGKPAPLDISPMQQEWQEVPPPVRSPVTRTFTRDPSSCRPVRPTSAHSSSPSSDSE
DGDDSCVAMTSSCASKQSLRLLLHRASEGGVSSPMLRRAIGDKQVEYLDLDLDLHTGRST
ATRQKRRTAGEERARVDYVVVDPRRTKALRSTREAWHDGRMSTEKE
Download sequence
Identical sequences G3Q4L3
ENSGACP00000024817 69293.ENSGACP00000024817 ENSGACP00000024817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]