SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000024858 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000024858
Domain Number 1 Region: 4-88
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.92e-28
Family Ras-binding domain, RBD 0.00000853
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000024858   Gene: ENSGACG00000018803   Transcript: ENSGACT00000024907
Sequence length 443
Comment pep:known_by_projection group:BROADS1:groupIV:17879872:17884521:-1 gene:ENSGACG00000018803 transcript:ENSGACT00000024907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVMELKVWVDGVQRIVCGVTEFTTCQEVVIALAQAIVPGRTGRYTLIEKWRETERHLAP
QENPVVSLNKWGQYACDVQLILQRTGPSVSERPASDGLARVPERGFYRQSLPPLAKLRPS
GTERSLKRREPKRKSLTFTGGAKGLRDIFGKSRDAEAKQSQQRGVSLSLSRVGGVGAGSV
PGSPARELSRLVQLQRDKLQALESRLLGCEGELQDWEEAAADEGGNLEEELLHLEQQVRR
NDAEMEEEEFWQNELQIECESERLLRQQLAELQGRVRDCEVKLSEYLAHIQRMEGGLEQE
QLQQEAELNQRANEEEVQAQLEKVRAELETQSQHTARLESSCRALEHSLGQSSSRLQEKE
QELEQLTKELRQVNLQQFIQQTGTKVTVLPAQPAGDNNNVLMHATEVDSGSLKRHGSSRL
LPSNLRTLQSAGKSSLNPEGIYV
Download sequence
Identical sequences G3Q4Q4
69293.ENSGACP00000024858 ENSGACP00000024858 ENSGACP00000024858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]