SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000024879 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000024879
Domain Number 1 Region: 18-76
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000285
Family Ubiquitin-related 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000024879   Gene: ENSGACG00000018810   Transcript: ENSGACT00000024928
Sequence length 308
Comment pep:known_by_projection group:BROADS1:groupIX:14567407:14575820:1 gene:ENSGACG00000018810 transcript:ENSGACT00000024928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKHYEVEILDAKTKDKLCFLDKVEPNATIGEIKSMFHKSHPQWYPTRQSIRLDAKGKSLK
DEDVLQHLPVGTTATFYFRDLGAQISWVTVFLTEYMGPLVLYLMFYFRVPFIYAAKYDFT
TSKHWVVHLACMCHSFHFVKRLLETLFVHRFSHGTMPLRNIFKNCTYYWGFAAWMAYYIN
HPLYTPPIYGEQQIRLALVLFLFCQIGNFSIHIALRNLRPPGSKTRKIPYPTKNPFTWIF
LLVSCPNYTYELGAWLGFTLMTQCLPVAFFTLVGFIQMTVWAKGKHRSYLKEFRDYPPLR
SPILPFIL
Download sequence
Identical sequences G3Q4S5
ENSGACP00000024879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]