SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000024885 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000024885
Domain Number 1 Region: 26-137
Classification Level Classification E-value
Superfamily PH domain-like 1.07e-35
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000125
Further Details:      
 
Domain Number 2 Region: 208-304
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 1.28e-19
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.000065
Further Details:      
 
Domain Number 3 Region: 392-496
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000000000000122
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000024885   Gene: ENSGACG00000018821   Transcript: ENSGACT00000024934
Sequence length 509
Comment pep:known_by_projection group:BROADS1:groupIV:18005474:18018916:-1 gene:ENSGACG00000018821 transcript:ENSGACT00000024934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IMSGHPSQRRQANVGSMQLTPQENECLFNHLGRKCISLSAAVVQVFTAERNSSWNKRCCG
VACLIKDNPLRSYFIRVLDIKDGKILFEQELYNNFNINPTKAYFITFAGDAYQVGLNFAH
EEEAKRFHGHVIDLLGKRQRKSEKRRDPPNGPTLPMATVDIKSPEISNAQRFHNSQVNNI
VHSSFQKREKKGKAKKKRLTKADIGTPSNFQHVGHVGWDPNTGFDLNNLDPELKSLFDMC
GISEAQLKDKETSRAIYDFIEKKGGVEAVKNELRREAAPPPPPSRGGPPPPPPHHSSAPP
PPPPARGRGAPPPPPPSRAPISAPPPPLPYGPGMSAPPPPPSRSSLPPPPPPMPQFQAPP
PPPPPPSFSNPSSAAPPPPPPPPPPPPPPGPMLPPQANGGDGGPPSISPGALLSQIREGA
NLKKVEPKERPTSTGTGRDALLDQIRQGTKLKARDDNTDSTPSPAAASAGIVGALMEVMQ
KRSKAIHSSDEDDNDDDDEDFEDDDEWED
Download sequence
Identical sequences G3Q4T1
ENSGACP00000024885 ENSGACP00000024887 69293.ENSGACP00000024885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]