SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000024895 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000024895
Domain Number 1 Region: 59-117
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000311
Family Ubiquitin-related 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000024895   Gene: ENSGACG00000018810   Transcript: ENSGACT00000024944
Sequence length 349
Comment pep:known_by_projection group:BROADS1:groupIX:14569711:14575819:1 gene:ENSGACG00000018810 transcript:ENSGACT00000024944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDALALEATSTKKPANGAAAASPLLGQAPSKRKPAKKAKKAVVFFEVEILDAKTKDKLCF
LDKVEPNATIGEIKSMFHKSHPQWYPTRQSIRLDAKGKSLKDEDVLQHLPVGTTATFYFR
DLGAQISWVTVFLTEYMGPLVLYLMFYFRVPFIYAAKYDFTTSKHWVVHLACMCHSFHFV
KRLLETLFVHRFSHGTMPLRNIFKNCTYYWGFAAWMAYYINHPLYTPPIYGEQQIRLALV
LFLFCQIGNFSIHIALRNLRPPGSKTRKIPYPTKNPFTWIFLLVSCPNYTYELGAWLGFT
LMTQCLPVAFFTLVGFIQMTVWAKGKHRSYLKEFRDYPPLRSPILPFIL
Download sequence
Identical sequences G3Q4U1
69293.ENSGACP00000024895 ENSGACP00000024895 ENSGACP00000024895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]