SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025001 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025001
Domain Number 1 Region: 14-81
Classification Level Classification E-value
Superfamily RING/U-box 5.3e-22
Family RING finger domain, C3HC4 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025001   Gene: ENSGACG00000018909   Transcript: ENSGACT00000025050
Sequence length 90
Comment pep:known_by_projection group:BROADS1:groupVII:1643380:1644249:-1 gene:ENSGACG00000018909 transcript:ENSGACT00000025050 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQNMSSPGGSVLTEDQFTCSICLEVFVEPVSTPCGHSFCKACLQGYWNHSKKFLCPMCKK
SYSKRPEMSVNRVLAEISSQFQGLMLAGGG
Download sequence
Identical sequences G3Q545
ENSGACP00000025001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]