SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025011 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025011
Domain Number 1 Region: 1237-1353
Classification Level Classification E-value
Superfamily PH domain-like 2.27e-26
Family Pleckstrin-homology domain (PH domain) 0.00054
Further Details:      
 
Domain Number 2 Region: 1067-1223
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.49e-20
Family DBL homology domain (DH-domain) 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000025011
Domain Number - Region: 751-855
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00108
Family Spectrin repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025011   Gene: ENSGACG00000018916   Transcript: ENSGACT00000025060
Sequence length 1374
Comment pep:known_by_projection group:BROADS1:groupVII:1694968:1712917:-1 gene:ENSGACG00000018916 transcript:ENSGACT00000025060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ACVWCIMILQSDLSALSTRLAGLAYPPNPPCYDIQLEAKRRMGSEAMEDCVQGALSSLYP
PFESTAPPLLSQVFSVLESTYQHDSLRYLLDYFVPAKHLLHKLQQHACSQYLGCLFLHSG
WPLCLGEKVVVQLSTLDWRILRSYDFYLQVVPFSTRCPRLALKCLAPGGRTVQEILVPES
QHPLVFTTEWLHSVNKERVGGGLDTCLVSTCDGVVRIPWKEVVYPKFIHDPSEELGLMSN
RKPSELPPDRSDSEPALLRRRRSEDGLGRTARHPQLDGDYVELLEPRVGPDGGVDTRQRY
LEMHGICKTKTLPLCRRGKAIKLRKGRAWGYGRLEGSGSFRAVLGSKNSVFEDAEKTVNE
DSDATTPTSDASERPYTGVLESGEIVGSKLKNSSKPKANKERDDGKTEDRACATGGKGRE
RGPKGGLGRVVVYTRRDQNCKVKLHKPIPTTRSALPKLPITEEDQSKARKRVDEPDGVPA
STHQGTGDTRKSSADKSQPTKWCYIERASPAEGTGPRVSTVREAKVDSLACSVRPLSYLV
TPTTGTVDRLGRALVVTETDASVEGVSEEEMARVLACYHRITRPAAKEKGLTVLMDSRRA
PPSTLFLAALKSFQVSVPGGLGSVLVLLGEQQESLSHDVEGAELHVDKQQLPQEMDGDFA
HCHADWLAFRLSLESLTEHCEGAVALLGEALRSMDTEPMPDDIKAVPLSIVKHGQLMASV
LADPRLTEPQQRGGAWLAGLTNSAPIRAALAATSKLYDSVDDALHRLVRVSNQRGRDLEA
LGRLAGLVDKLEKEIEQVQSHLEDYKDPPLSLSRLSLKQQKFKTFRETADIRLPPVREKL
RDMSHCLSDCWTTLDNTQRLLSTLTEVAPHRTPRRRGASRRATQWCEVVSSSASSTCPLA
SLPPIPPSRFQDARSLAMELGGGALLDLWTQTVERYQRTVAQVKPRTGPRTRPRGGRRRR
PPAASHRGAAPCEAAQEAPPELRPPGPPGSPQSHGLPEARRVPGGRGQPQLAHVVAGEAG
GGRPRGVLIRGVEVSSKEVVDHTGSPRQHVLLGRTERETGADRAGSTAQRMLSSERQYVA
ILKGVEETYLPLLELSDTPASFRWKADVLFPNWAALSAFHSQNLLPAMEGALVQSLLQQD
CFSKYREQFLQYSHYIRNKPELDSPLSKLPPASPLSPLSFPHCLQAPTQRLEQYCEALEE
LGGMNPASDSALSILRHAQRHGEDLRASDLIVGCPIPVAERGELVRHGELMVCGGTRRKR
AGVRNVFLYQHAVVFAKQKSPAPGRSAYSYKHSIKTGEMGLTQSVGGEGLKFEVWVRQAP
RTRDCVTLQAKDAEDKAAWTRDIAHLLWTHAINNTELCLKESLCMGISSKLLLD
Download sequence
Identical sequences G3Q555
ENSGACP00000025011 ENSGACP00000025011 69293.ENSGACP00000025011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]