SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025018 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025018
Domain Number 1 Region: 318-402
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000125
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025018   Gene: ENSGACG00000018920   Transcript: ENSGACT00000025067
Sequence length 405
Comment pep:known_by_projection group:BROADS1:groupIX:14877441:14882911:-1 gene:ENSGACG00000018920 transcript:ENSGACT00000025067 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQGGSQDPSHGTGDVGELAHTLSKETLASPDASELGSPRCTPNFDLFNMVVSYKRMALFL
EPAADAVELSRFLLRWKMPVCSLFVCMFLNCFFCTVNEVGWITVGVVAVAAPAALGYLQD
RYGGRASDSELHKRRYHAVHRRDLLTVHLTKQEAMLEVKDLLKHLDDMLSSACLLAETFY
KVLYWDNHTKSSRCYGGMLIFACLLYIAPLGWVLAGLNSTVFLWNRDFCRVLLDLRNMLQ
TGRAKASEGKCEEQEHGHSLDQTPTPTSLEDLSPGSVEEAEEAEPDDEFKDAIEEDDDGP
LGAPEYDTISENGLLSRNEPIRSKVSKLTEKLRKRYPTTSTGNCSSCNAVFSVLKKRRNC
SNCGNSFCSRCCSFKVLRSCMGATAPEAQRETVFVCAACNSSLIK
Download sequence
Identical sequences G3Q562
ENSGACP00000025018 69293.ENSGACP00000025018 ENSGACP00000025018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]