SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025037 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025037
Domain Number 1 Region: 511-698,786-1111
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.64e-71
Family Tandem AAA-ATPase domain 0.029
Further Details:      
 
Domain Number 2 Region: 264-288
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000471
Family CCCH zinc finger 0.0044
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000025037
Domain Number - Region: 129-180
Classification Level Classification E-value
Superfamily UBA-like 0.00222
Family UBA domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025037   Gene: ENSGACG00000018935   Transcript: ENSGACT00000025086
Sequence length 1353
Comment pep:known_by_projection group:BROADS1:groupIV:19670965:19680411:-1 gene:ENSGACG00000018935 transcript:ENSGACT00000025086 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGKPGGRGRGGGGSKKAGVGGWDDGDDFRLEFGPPRPSRTRTSPKLGESIRPEMSSMPMQ
RLFMTNENQEQLKELLRNLQTQDFDEPYYSGEDGDEEEFDELDHRDEGQFWATTDEPVEK
AESPAYDTESDDERPTPEPVISLFAIGKLCRYGFDRERGKKALQSGGGEFGVTLEQLLSQ
IFIERYGQKAVSPDGLEVVPMDECLSQRQEEALALTAIYGERFSERIANVVWTVTLDVSF
LSDNAAKNGRQVGSRGGGAVSIRDVCRFFLKGQGCRFGDKCKFKHQLPTKGSSRAGSPDL
DGPSRPGFSSSSPPEYELEVRFPRGNRYPFQAPIVAFSTTDESFGAAGRLSVTERLFGEA
LAAAKSNEPVVYTLITLCEDETIMRELLAVSHHKFSTPPPVVVLPPPAPTVAKSKSTRNS
AAEESRSSSNNNIKETGETEEPDERDEEDEAVPVETESYVNLRKKIVNKHNLKTDNVLKE
NGKLCREFKMKMSSGRFRSMLEQRKKLPAWQEKENILDLLDQCQVLVVSGMTGCGKTTQI
PQFILDASLGGPADQVVNIICTQPRRISAISVAQRVAQERAERLGNSVGYQIRLETVRTS
ATRLLYCTTGVLLRRLESEADLTGISHVIVDEVHERTEESDFLLLVLKDLILQRPDMKII
LMSATLNANLFSEYFYKCPTIHIPGRTFPVDQFFLEDAITKTRYVIEDGSPYMRSGKQNS
SFTSGRGGKADQRDVVDDLGDDMWNFMSLCKKDFVKDSIPDQQLSLQELTVRFKDTKKSV
LKTISAMDLDKINMDLVESLLEWIVDGNHDYPPGAVLVFMPGLAEIKMLYEQLSSNRMFN
NRGATRCEVYPLHSTLSNEEQQAVFSRPPDGVTKIIISTNIAETSVTIDDVVYVIDSGKM
KEKRYDATKSMESLEDSWVSRANALQRRGRAGRVASGVCFHLFTSHCFQHQLAEQQLPEI
QRVPLEQLCLRIKILDLFAERTLESVFSRLIEPPAMESLDAAKQRLRDLGALTADEKLTP
LGYHLACLPVDVRIGKLMLFGAIFRCLDPALTIAASLAFKSPFVSPWDKREEANEKKLAF
ALAGSDHLALLQAYKGWCCAAKNGRQAGFVYCRENFLSSRGLQEIASLKRQFAELLSDIG
FIKEGLRARVMERMSSKGTDGVLEATGPEANLNSDNIRLMSAMLCAALYPNVVQVRAPQG
NYKMTSKGAMKMQPKANELRFMTKDDGPVHVHPSSVNYTVRHFDSPYLVYHEKVKTSRIF
IRDCSMVSVYPLVLFGGGQVNVELQKGEFVVSLDDGWIRFAAASHQVAELVKELRWELDQ
LLEDKIRSPSIDLCTCPRGSRIIHMIVHLVSTQ
Download sequence
Identical sequences G3Q581
ENSGACP00000025037 69293.ENSGACP00000025037 ENSGACP00000025037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]