SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025078 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025078
Domain Number 1 Region: 766-882
Classification Level Classification E-value
Superfamily Bromodomain 6.15e-25
Family Bromodomain 0.00092
Further Details:      
 
Domain Number 2 Region: 185-248
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 2.01e-16
Family B-box zinc-binding domain 0.0018
Further Details:      
 
Domain Number 3 Region: 684-751
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000000113
Family PHD domain 0.0022
Further Details:      
 
Domain Number 4 Region: 42-106
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000321
Family RING finger domain, C3HC4 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025078   Gene: ENSGACG00000018967   Transcript: ENSGACT00000025127
Sequence length 976
Comment pep:known_by_projection group:BROADS1:groupIV:19983324:19993225:-1 gene:ENSGACG00000018967 transcript:ENSGACT00000025127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDESLENVDNDDIVIIVENEAESLPAEDERLKPQGAFGLMDTCPICKLSFHNREPKLLPC
LHSFCKRCLPVPHRSADPRRDSQAPVDSKSLGAVRCPVCRQECWEMDMLDNFFVKDSAEV
PSSTMEKSSQHLVPFCLCLWMQPGNLRRCQQTFLAKFVSKSKKVYISLRSTLPALHVRIP
EALGVSTQKPVFCDVHKQEPLKLFCETCDRLTCRDCQLLKHKDHNYQFLDDAYRNHKQHL
ENMTQQLQEKRKAIEDVSSCISSGLQHVEENRKAVTNEIKKSICNLIMEINRKGKILVNQ
LEALTKDHELGLKKQQDDVNSLSRHLDHVIRFTKWATASHSGTALLYCKRLILFQIHYLM
RASCNPSIVPQSSVRFQCRSGFWATNVDLGSLVVERGQSRTPITTHPAGPRAEAPAGGLS
ASAQQTVRQSTLAQLQMHVDKLAHQPNRQPPPNHWSWYQNVRVPGHPGLPPPTRPSHGGS
SPSQGPPSLGQPGRRYGSSYPNPRSPTSSMLHNTGFPPAQSLRDLIHSSSFPSKPMEVLQ
GTSRYPQPLSAGAAAQMSLQRGLTESSYLRRSEAGGSVPSITISIPKPSFAPSLSSATAD
KTIQARQNSPMAKPSSSDRGTGTTSWRQSSEPPSASSAKRRRRSSPGPVIVIKDEPEDED
DVRFVQSSVGSSLPDSSTGAQQRGPPVAAQPECEKRAVPEEDPNEDWCAVCQNGGELLCC
DKCPKVFHLACHIPALNESPSGEWFCSLCRDLTSPEMEYVCDSKDDPVSERFPPHGRRKC
ERLLLRLFCNDFSTDFQQPAAPSETRRYKELIKNPMDLSIVKKKLESKSPEGDGYSGPEE
CVADIRLIFFNCAKYYKATSEVGSAGLYLEDYFEEQLKLVFPDAVFAGGREEQMIPPLEE
EIDEEEEMAAEGAAPVKDDKPQSPAGKGIPPVEEDLPPLEEDLPPLEEEEEEIPAEEAEC
PLAAEAETKEEEPPKS
Download sequence
Identical sequences G3Q5C2
ENSGACP00000025078 69293.ENSGACP00000025078 ENSGACP00000025078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]