SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025092 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025092
Domain Number 1 Region: 338-394,423-627
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 2.75e-41
Family PhyH-like 0.079
Further Details:      
 
Domain Number 2 Region: 54-165
Classification Level Classification E-value
Superfamily ARID-like 1.31e-29
Family ARID domain 0.00063
Further Details:      
 
Domain Number 3 Region: 275-338
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.99e-17
Family PHD domain 0.0018
Further Details:      
 
Domain Number 4 Region: 1125-1215
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000000842
Family PHD domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025092   Gene: ENSGACG00000018981   Transcript: ENSGACT00000025141
Sequence length 1612
Comment pep:known_by_projection group:BROADS1:groupIV:20004820:20014379:1 gene:ENSGACG00000018981 transcript:ENSGACT00000025141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AEFVPPPECPVFEPSWEDFSDPLGYINKIRPIAEKTGICKIRPPEDWQPPFACDVRNFHF
TPRVQRLNELEALTRVKLNFLDQIAKFWELQGSKTRFPHVERKVLDLYQLSKIVSSEGGF
ESACKEKRWSKVASRMGFPAGKGTGSLLRSHYERILYPYELFQSGATLTGVGEEADEDEE
QDEEEEEEEEKDGEGDTMQTKEQLLPERRSRRLKSESVSGVQAENKEPKGLKIFGTSPKM
VGLEIVSADDGLNKKQRHLKAQAFAIKMRPRKETLEVNFIDLYLCLVCGRGDEEDRLLLC
DGCDDSYHTFCLIPPLQDVPKGDWRCPKCVAEECSKPREAFGFEQAVREYSLQSFGEMAD
HFKSDYFNMPVHMVPTELVEKEFWRLVSSIEEDVIVEYGADISSKEVGSGFPVRDGKRRL
LGDEEEYANSGWNLNNTPVLEQSVLTHINVDISGMKVPWLYVGMCFSSFCWHIEDHWSYS
INFLHWGEPKTWYGVPASAAEKLEAVMKKLAPELFDSQPDLLHQLVTIMNPNVLMEHGVP
VYRTNQCAGEFVVTFPRAYHSGFNQGYNFAEAVNFCTADWLPMGRQCVAHYRRLHRYCVF
SHEELLCKMAADPESLDVELAAAVVKEMAEMMEEETKLRQAVQEKGVLSSEQEVFELLPD
DERQCHKCKTTCFLSALTCSCSPDRLVCLSHAADLCDCPPGNKCLRYRYDLEEFPSMLHG
VKTRAQSYDTWAKRVTEALAADQKNKKDLIELKVLLEDAEDRKYPEKALFRRLREMVKEA
ETCSSVAQLLLSRKQRHSARLRSEISRNRTKLTVDELKAFVDQLYRLPCIISQARQVKEL
LENVEDFHERAQVALSDEMPDSSKLQALLDLGSGLDVELPELPRLKQELQQARWLDEVRV
TLAEPHRVTLELMKRLIDSGVGLAPHHAVEKAMAELQEILTVSERWEDKARACLQARPRH
GMATLESIVLEARNIPAYLPNILALREALLKAKDWTSKVEAIQSGSSYAYLEQLESLLAR
GRSIPVRLDPLVQVESQVASARAWRDRTGRTFLKKNSTYTLLQVLSPRVDIGVYGNSKSK
RKRVKELMEKERVGFDPDALSDLEESLEEARDPSTVVSAFKSKEQKEVEAIHSLRAANLA
KMAMADRIEEVKFCLCRKTASGFMLQCDLCKDWFHGACVPLPKTGTQKKAGGGWQSNSKD
SKFLCPLCQRSRRPRLETILSLLVSLQKLPLRLPEGEALQCLTERAMSWQDRARQSLATE
ELSSALAKLSVLSQRMVEQAAREKTEKIINAELQKAAANPDLQGHIQTFQQSGFSRAASP
RQSVDYDDEETDSDEDIRETYGYDMKDPGEVKPYLFCDEEIPVKSEEVVSHMWPVVTPSF
CAEHAYSSASKSCVQNMSTPRKQPRKTPLVPRSLEPPVLELSPQAKAQLEELMMLGDLLE
VSLDETQHIWRILQATHPPSEERFLQVMEPDDSLMEKPLKLKLKDSEKKRKRKLERAEQH
HMLMAAASKELKRVGLELGLGGKPKKKKLKLNLDKNREMKQLAKRLVKEEKERKRKEKAA
SKAEAVREGLEKRKEKKILDIPSKYDWSGAEDSNDENAVCASKTCQRPCKDK
Download sequence
Identical sequences G3Q5D6
ENSGACP00000025092 ENSGACP00000025092 69293.ENSGACP00000025092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]