SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025112 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025112
Domain Number 1 Region: 288-475,785-932
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.12e-114
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.000000578
Further Details:      
 
Domain Number 2 Region: 6-119
Classification Level Classification E-value
Superfamily DUSP-like 4.18e-36
Family DUSP, domain in ubiquitin-specific proteases 0.000000804
Further Details:      
 
Domain Number 3 Region: 146-217
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00005
Family UBX domain 0.064
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000025112
Domain Number - Region: 513-599
Classification Level Classification E-value
Superfamily EPT/RTPC-like 0.0602
Family RNA 3'-terminal phosphate cyclase, RPTC 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025112   Gene: ENSGACG00000018996   Transcript: ENSGACT00000025161
Sequence length 980
Comment pep:known_by_projection group:BROADS1:groupIV:20026722:20041153:1 gene:ENSGACG00000018996 transcript:ENSGACT00000025161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGGAADLDTQRGEVSALLKTQLRKGDTWYLVDSHWFKQWKKYVGFDSWDKYQMGDQNV
YPGPVDNSGLLRDGDVLAIKEHLIDELDYILVPTEGWNKLVSWYALTENQEPIARKVVEQ
GMFVKHCKVEVYLTELKLCEDSNMDNVITRRFSKADTIDTIEKEMRKLFTIPDERETRLW
NRYMSNTFEPLNKPDSTIQDAGLYQGQILVIEQKSEDGTWPRGSTAPKSSGASNLSALPK
ISPSSLTNHNSSFNSRNVKNSSYSLPSYHPYSNSYDYSDQSRQSERSGLCGLSNLGNTCF
MNSAVQCLSNIPPLTEYFVKDKFTDELNKDNPLGMKGEIAKAYADLIKQMWSGKFSYVTP
RPFKTQVGRFAPQFSGYQQQDSHELLAFLLDGLHEDLNRIRKKPYIQLKDANGRPDKVVA
EEAWENHVKRNDSIIVDIFHGLFKSTLVCPVCSKVSVTFDPFCYLTLPLPMKKERTLEVY
LVRLDPLAKPTQYKLTVPKVGYISDLCTSLSNLSEVSAEKMIVTDIYNHRFHRIFATNEN
LSSIMERDDIYVFELAVNRVEDTDHVVIPVHLREKYKQSGYNHTSTPLFGQPFLLAVPRT
LSEDKLYNMLLLRLCRFVRSSVEEDEEACQETSKQHAVNGNGTNGLQEEGSPSEMETDEQ
DEESSQDQELPSENDNSQSEDSVDNELENGVVGPQNSTKQTAGRSRKRLFTFQFNNMGKT
DFSLIKEDTRQIRFDEGHLRLSDRSYLSLDWEPEMKKKYFDETVVEEQDFDKHESMEYKP
QKKAFFKLKDCIELFTTKEKLGAEDPWYCPSCKQHQQATKKLDLWSLPPVLVVHLKRFSY
SRYMRDKLDSLVDFPLRDLDMSEFLINPNAGPCRYDLIAVSNHYGGMGGGHYTAYARNKD
DEKWYNFDDSSVSPANEDQIVSKAGYVLFYQRQDTVKGTGYFALDRASSSAAASAGAQSD
EEDLNENRRRMNNNEQGDEQ
Download sequence
Identical sequences G3Q5F6
69293.ENSGACP00000025112 ENSGACP00000025112 ENSGACP00000025112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]