SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025128 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025128
Domain Number 1 Region: 569-683
Classification Level Classification E-value
Superfamily Bromodomain 2.88e-31
Family Bromodomain 0.00046
Further Details:      
 
Domain Number 2 Region: 1022-1134
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.73e-18
Family PWWP domain 0.01
Further Details:      
 
Domain Number 3 Region: 216-287
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.65e-18
Family PHD domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000025128
Domain Number - Region: 328-364
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00244
Family PHD domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025128   Gene: ENSGACG00000019009   Transcript: ENSGACT00000025177
Sequence length 1153
Comment pep:known_by_projection group:BROADS1:groupIV:20220967:20230106:1 gene:ENSGACG00000019009 transcript:ENSGACT00000025177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKKARQHRVAVPQRPPSPIKPSPNKQILTYAQAQRMVEFAVDGRLHRISIYDQLDVVSD
DDPMVQEMMECTSNKENAEKPPQQVLVRSVRLKNNQDKRNAALGINAHGEGGGHQAASNA
APKLQEPKFRTVEYNLPAVPKPSAAFYKYAEKTEEELDEETEYDMDEEDYAWLDLVNDKR
RSEGVSQVSHNVFEFLVDRFEKELHLESLDQSGEKQAPVDEDAVCCICGDGECHNGNAIL
FCDLCNAAVHQECYGVPYIPEGQWLCRHCLQAPARPADCILCPNKGGAVKKTDDGRWGHV
VCALWVPEVGFSNTTFIEPIDGVGQIPPARWKLTCYLCKEKGVGACIQCHRANCYTAFHV
SCAQKAGLFMKMEPIKDVTDAGEATFSVKKTAYCGAHTPSGCVRRPLTIYDAGKPRNGLC
KKVDKGRAVGKRQSKGKKKSSKRPEPEPEAAILAAVPSFPVHRLQTILNQVSVQKKRAFV
ELVLNYWTLKRQSRNGLPLIRRLQTSMLSQKNAQPRQCEEESRALKDQLKEWHRLRHDLE
RARLLLELIRKREKLKREEIKLQETLLEMQLSPFSILLRALLDQLQTKDQAKIFTQAVDV
DEEAVMDQVPDYLDHIKHPMDFSTMRQRIDTQAYNNFDQFENDFNLIVDNCMKYNSKDTY
FYRAAVRLRDQGGSLLRKARRDVEKIGFDSESGVHLAEAPEIKAPTSFSWEDVDRLLAPA
NRQHLPLDQQLQQLLEKFDLTCSMKSSPSRSKRLKLLKKTINDVRNEMSLKRVLPSGGFD
GEAPELLCSTPSRLNGHSLDGLRASLLDGDVSVVATSTLAEPACSVNRRTAVLFRKSKAA
GPHKLPARSRAGEGLDGADGKGPPSTEGAQLGFLSVVIPRLETLLHSKKRKHGSGSSRDS
ESPVKRLDTGLSSGFLEVVEEEEPVGSNGAGRAAEPRRRCASESSISSCSSLPGSTSLPK
CGKGKPALVRRNTVDDKSELIACIETGNFAKAARIAAEHSMASIEVGNSNIWMPASAATV
ALEPLKLVWAKCSGYPSYPALIVDPHMPRVGCQHNGVSIPMPPMDVLRIGEQMQYKAEEN
LYLVLFFDNKRSWQWLPRSKMVPLGMDKTIDKIKMMEGRTSSIRKAVQVAYSRAINHLSI
VQDEPVSDLSDVD
Download sequence
Identical sequences G3Q5H2
ENSGACP00000025128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]