SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025173 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025173
Domain Number 1 Region: 167-204,310-402
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000439
Family UBX domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025173   Gene: ENSGACG00000019046   Transcript: ENSGACT00000025222
Sequence length 496
Comment pep:known_by_projection group:BROADS1:groupIX:15258431:15265948:-1 gene:ENSGACG00000019046 transcript:ENSGACT00000025222 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APMCSRLSMPDNMVVRIALQMQDGSRLQGSFSCGQSLWELLTHFPQIRCLSESESTPVCV
YMREEVCGEEALKKATLKSLGLTGGNAIVRFVLKKNKVPGQEDAVDATETAAANRSSNSR
PCPMQQTSRSTGRGKPEEDGEKAGPSGLNSDPSTPPVAAPSAPFIPFSGGGQRLGGPRGS
AAGRSLSSSSSSSSLPALTAAVESPKAKKAKSSHSSLTKVSPISPKHVKILSLTLALFLQ
PVGREPLVYHLDAMSRHSADQRDPPDEFFEVTMDDVRKRFAQLKSERKLLEETPLMTKSL
REAQMREKMERYPKVVLRVQFPDRHVLQGFFRPLETVGAVMHFVRSHLQDPQLSFYLCKS
LLLLSKSHTVSSSIITPPKTILDDPSATLFQADLFPGALVYFGSDAKTDFYMKTDLLESS
VSALQANESIARYRSPTASSACEGSEEPLPPPEPTEETSGSTRGEADPTAPTRAARPTGS
DPGKVPKWLKLPGEDG
Download sequence
Identical sequences G3Q5L7
69293.ENSGACP00000025173 ENSGACP00000025173 ENSGACP00000025173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]