SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025262 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025262
Domain Number 1 Region: 2-162
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-43
Family DBL homology domain (DH-domain) 0.001
Further Details:      
 
Domain Number 2 Region: 154-277
Classification Level Classification E-value
Superfamily PH domain-like 2.13e-27
Family Pleckstrin-homology domain (PH domain) 0.0053
Further Details:      
 
Domain Number 3 Region: 259-366
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.8e-19
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000025262
Domain Number - Region: 392-426
Classification Level Classification E-value
Superfamily PH domain-like 0.0993
Family Pleckstrin-homology domain (PH domain) 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025262   Gene: ENSGACG00000019105   Transcript: ENSGACT00000025311
Sequence length 428
Comment pep:known_by_projection group:BROADS1:groupIV:21569886:21572882:-1 gene:ENSGACG00000019105 transcript:ENSGACT00000025311 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VIRNIFSNISSIYSFHSQFLLPDLESCIGQWGESPCLGGVLLQHAPFLRMYAYYILNFDQ
AMELLRTWSERSSVFRDIIQDIQSQEVCGSLTLQHHMLEPVQRVPRYEMLLRDYLTRLPS
DSPDYDRSRESLQIISMAATHSNSALHKAECRKRLLEIYEMVGEEEVVNPTNEFLREGRL
LKLAARNTSAMERHLFLFNNFLLCCTPKFSLVGQRFTVRCRIGVDGMQVQQTTNEDHLHT
FQVSGKERTLELQASSEQDRDEWIKVIQEAIDVFLKKHETFKLTCNEPDVEESTEELGRR
APRWIRDNEVTVCMKCEEPFNAITRRRHHCRACGCVVCWKCSDNKVALAYDCNKLNKVCK
SCFSILMEQRVEGKKRTVLESEAARVCSDGAVRGFLRYGDNPKTWHQMWAVVPWSEPAVL
HLYTAPQV
Download sequence
Identical sequences G3Q5V6
ENSGACP00000025262 ENSGACP00000025262 69293.ENSGACP00000025262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]