SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025304 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025304
Domain Number 1 Region: 74-534
Classification Level Classification E-value
Superfamily Ras GEF 1.44e-100
Family Ras GEF 0.00044
Further Details:      
 
Domain Number 2 Region: 609-705
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.42e-34
Family Ras-binding domain, RBD 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025304   Gene: ENSGACG00000019135   Transcript: ENSGACT00000025353
Sequence length 719
Comment pep:known_by_projection group:BROADS1:groupIX:15484553:15496643:1 gene:ENSGACG00000019135 transcript:ENSGACT00000025353 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKLLWLRASPCAATEPGVWLTGFQALDNDDGRYEDPVQEWGEEKEDGAVFVVTLRRELV
PPSPDTPEPPTAFSFVQYHAVKVRRLKAGTLERLVAHLLDPEHQEPDYTQIFLCTYRTFT
STSTLVKLLFQRVSVCYAPSTPLQEDSVVDLGNTVCQRNALFLVIQLLLEEHGEDFHEPP
QCQALQMLCVHLRHRRCFRRLAHTAENLLKSLKERGTGEWQTGLPWITLSHGTSGELGDP
EDSADTSIREEDKCNFMDFAVREVAEQLTRLDAELFVRVKPFHCLGCVWSQRDKRQNRNL
APTVRATISQFNAVTNRVITSILCSPGLRARIVEGWIAIAQECRQLKNFSSLRAILSALQ
SNSVYRLKKTWAAVGRESMNTFDHLSETFPNENCVLTSREILVEVTACVHDDGAHPDGGA
TAGSESRPSFSSGVVPYLGTYLTVLTMLDTALTDTVEGGLINFEKRRREFEILSQIRQLQ
ASSSRYSLPVNAQITTWLQAHTLLTDQESYELSRDLEPPVDPCPTSPSSWSSLLTKKHAT
SQTGSNSYLRKTQADQMSVSSSGSSSSEMEDLAVPQLSPLRLKQPDLCSSSVALSPESSL
SGCSSPAALPLYNKQGADSCIIRVRVESVSNGNVYKSILLTSQDRTRQVIERALEKHNME
DSSCHDFNLFQMLNNGKDLQIPDKANVFYAMCPSADNDFVLRRRWRSHGSRLCASSSPG
Download sequence
Identical sequences G3Q5Z8
ENSGACP00000025304 ENSGACP00000025304 69293.ENSGACP00000025304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]