SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025368 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025368
Domain Number 1 Region: 732-1095
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.16e-98
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.0000000000371
Further Details:      
 
Domain Number 2 Region: 550-730
Classification Level Classification E-value
Superfamily ARM repeat 3.07e-59
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.000000119
Further Details:      
 
Domain Number 3 Region: 148-322
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.88e-51
Family Ras-binding domain, RBD 0.000000845
Further Details:      
 
Domain Number 4 Region: 352-521
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.87e-47
Family PLC-like (P variant) 0.00000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025368   Gene: ENSGACG00000019186   Transcript: ENSGACT00000025417
Sequence length 1109
Comment pep:known_by_projection group:BROADS1:groupIV:22364132:22374435:-1 gene:ENSGACG00000019186 transcript:ENSGACT00000025417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EQNQLSDEEPKILREETRRRRRKKAISSSSCPSMDQISVEFVLPTAARGGSGTEILLLEV
AGNWTVEQVKAQVWLKAVTLNLCPDFYQRFSPDHCILLYQKKGNVCEIYDKHQVFQTLDC
IRYWRAKALKKDVGRIQLVPRPQPADDSLQYQSYLNYLIGYDVTDVSNVHDDELEFTRRK
LLTPRRIELTDRDAKLYSMDPWVARKPLPEHLLSKVSNAHVLLVIHISTASQTIKVSLQD
TPAQVLASFFAKTANKRVLLGIPQNMCEADFVLRVCGREEYLYGDKPLQDFNWIRQCLKN
GDEIHLVLESPPDTDLDLVQKEDWAQVDDCTGVAGTHEQLTIDEKDHERVFTVSMWDCNR
KFRVKVLGIDIPFLPKIPEFIVFIEASIFHGQQLLAQERTCSKNFSEEVLWNCWLEFNIK
IRDLPKGARLNLQVVCGKQPPTANSKGASGKTKSRLLYYVNLLLIDHRSLLRQGEFILHM
WKMPEKSEESSSSINADKLTSATNPDKASAMAVAILLDKYCYPVVLPKSRNLVCRDAGGE
EVEGGERGQREMPNHLKKQFAAIVATDPLHPLSPEDKELLWHFRHECMRDPRAYPKLLGS
VKWGRQEDVLATHRLLERSSAWDSSGLDVGLAMQLLDCHYSDAQVRSMAVRKLETLEDDD
VLRYLLQLVQAVKFEPYHDSALVRFLLKRALRSKRIGHFLFWFLRSEIAQSMHYQQRYAV
LLEAYLRGCGEDMLQDFRKQVEMTEALQKVTREMKAMSADKCDITAQVVFQLRQKLETLQ
SSGLPESFRVPYDPGLRAGALMIEQCKVMASKKKPLWLQFKRADQTTLSRDPIGIIFKEG
DDLRQDMLILQILLIMESIWETETLDLCLLPYGCISTGNRIGMIEIVKDATTIANIQQSV
MGSTGAFKDEILSQWLRDKCVSEDKFQQAVERFLYSCGGYCVATYVLGIGDRHNDNIMIT
ESGNLFHIDFGHILGNYKSFMGISKEWVPFVLTPDFLYVMGTTGKKSSPHFQKFQDVCVK
AYLALRHHTNLLIILFSMMLMTAGMPQLTSKEDIEYIREALTVGRSEDEAQRHLLDQIEI
CREKGWMVQINWFVHLVLGIKQGVEKRST
Download sequence
Identical sequences G3Q661
ENSGACP00000025368 ENSGACP00000025368 69293.ENSGACP00000025368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]