SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025451 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025451
Domain Number 1 Region: 56-204
Classification Level Classification E-value
Superfamily PH domain-like 2.26e-39
Family Pleckstrin-homology domain (PH domain) 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025451   Gene: ENSGACG00000019253   Transcript: ENSGACT00000025501
Sequence length 1086
Comment pep:known_by_projection group:BROADS1:groupIV:23209606:23250489:-1 gene:ENSGACG00000019253 transcript:ENSGACT00000025501 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EAEVHQELSWCINHNERQVTCKHPVSGVPSQDNCIFVVNEQTISTNSSSDKKERPMSTMS
EASNYTGGSDYSTFPGSPATTPSRSFKKVHNFGKRSNSIKRNPNAPVVKSNWLYKQDSTG
MKLWKKRWFVLCDMCLFYYRDEKEDNILGSILLPSFHISMLSVDDHISRKYAFKATHPNM
RTYYFCTDSAKEMESWMKVMTDAALVHTEPVRRSVLNTFRLDKLKVDQRTPQELNMLLNH
RVLTRPEIQNNERNREPVQQQRSLSQEIYGYQSAERPLTKISSIKLQPAQAAAIASAVSA
SRHGQANLNVPIPAQINGSGSTVDKRTGDCSPAEVDSSMALGPGKSPASVQEPERGLSRT
NSMQQLEHWVRTYRTRGLDDDTRSVTSYQTLPRNMPSHCPQIVPRYPEGYRTLPRNTMMR
PDSICSVAGSVYDQALRPASTVTTAEKRRSMRDDTMWQLYEWQQRQAFSRHSLAQPTAMG
HYGTLPSTKTMGNISEYAVAHSIPTSPSHGSLALYSTFSPPRQQVAPNPSNSQPDVSSPV
LSGDVTQEQWHRTHVTKYGYQPDRRSLPVPPQSITPQSLQGKTPEELTLLLIKLRRQQAE
LTSLREHTVAQLMALGLEGPNAKTDVLSHHLQRNLVYLDSQTKDNEPLIFTIHTMIENSA
PRPQLYQQFLMNIKYISKMLGTSPDDFKDGSFIQHTEEPNIDTKLSRLCEQDKAARMQEE
KLQQLHREKHTLETALLSASQELSEQSGSNAAATKSLVQQRDVLQGGLLSTCRELSRVTT
ELERSWRDYDKMRADVTMAKSNLLEQLEALGSPQTEPPSQRHIQIQKELWRIQDVMEALA
KNKPQRSTDSTALPGSKALPSRQKDEEGDTLPPRPPLPQYYNSSVRPTHTHPHYSHPGGR
LPPHMHRSEDRKASARNGVNSQAPDYRLYKSEPELTTVKEEGDEANSEDKNKMERSAEIP
TVPPYPVGIILPRTKSPMSPSESSNIPSYVTLRKPKKPESRPDRPRSVVDQTGFGEREMG
RTRMSVEEQLERIRRNQQASALREKKRENPSRSPSFSKDNPFIIQQVMEMEEVKNELEEM
QRYGDV
Download sequence
Identical sequences G3Q6E2
ENSGACP00000025451 ENSGACP00000025451 69293.ENSGACP00000025451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]