SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025454 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025454
Domain Number 1 Region: 452-721
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.04e-75
Family Protein kinases, catalytic subunit 0.000000000171
Further Details:      
 
Domain Number 2 Region: 118-190
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.08e-24
Family Ras-binding domain, RBD 0.00032
Further Details:      
 
Domain Number 3 Region: 190-243
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000136
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025454   Gene: ENSGACG00000019257   Transcript: ENSGACT00000025504
Sequence length 771
Comment pep:known_by_projection group:BROADS1:groupIV:23333736:23353663:-1 gene:ENSGACG00000019257 transcript:ENSGACT00000025504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QIWNIKQMIKLTQEHLEALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLEAMGN
GTDFSCSPSPMPALLEVMSGGCGVAGGAQAFPSAPNTLAVLQTPTDAGRANPRSPQKPIV
RVFLPNKQRTVVPARCGMTVRDSLKKALMMRGLIPECCAVYRIQDEEKKPIGWDTDISWL
TGEELHVEVLENVPLTTHNFVRKTFFTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVP
LMCVNYDQLDLLLVSKFFEHHPFTQEEVSSEGTTPVSDACPSLPPSDSTGSMCHTTLSPS
KSIPIPPSFRPNDEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGLPRSDGAPPT
HPARCLRKHRTRTSSPLLYSYPNDIVFDFEPEPVFRGSTAGLSATPPASLPGSLTNVKVP
QKSPCQQRERKSSSSSEDRNKMKTLGRRDSSDDWEIPEGQITLGQRIGSGSFGTVFKGKW
HGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYTTKPQLAIVTQWCEGSS
LYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFG
LATVKSRWSGSHQFEQLSGSILWMAPEVIRLQDKNPYSFQSDVYAFGIVLYELMSGALPY
SNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMADCLKKKREERPLFPQILASIEL
LARSLPKIHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGCYGEFSAFK
Download sequence
Identical sequences G3Q6E5
ENSGACP00000025454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]