SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025459 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025459
Domain Number 1 Region: 10-218
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.09e-48
Family DBL homology domain (DH-domain) 0.00036
Further Details:      
 
Domain Number 2 Region: 205-331
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000315
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025459   Gene: ENSGACG00000019259   Transcript: ENSGACT00000025509
Sequence length 424
Comment pep:known_by_projection group:BROADS1:groupIV:23361518:23412471:-1 gene:ENSGACG00000019259 transcript:ENSGACT00000025509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFSPGPSGPLGGTNIQEQRDRWERKRSRTARELVQTEQRYCQQLELVTTYFVEILKAKG
TLKQDIRESIFSSIKAIHSVNQSLLVHLENGYFGRGFDQMCPHLQHYNTYVDNIYNGSRV
LGIQMKKNKPFRRFKKLQEARPEFNNHKLEDLLQLPIQRIHQYKHFLQDLTANTSPDNPE
FPQLSRAVDAVNEVFQRIQNNTRRHENHLQLCRVQKLLKGKKTKVLAEGRWYIREGWLTV
VPPKGADTTPRMFFLFSDMLLQAKLQLTSRDKFAGQHAYPLQGCSVEKVFGHTRSQGGLL
SLTFPKAKLLLMSCNQEDLNDWFQSLSAAIGKLQGKQTLVHQREVELCRRPLRSAVVCHN
TPSSSRKRNMVRHTQTPQTCRHSSPNFLSPLTHLEGSVAKRMKPTNAPEHSSAAEASLSS
CVIL
Download sequence
Identical sequences G3Q6F0
ENSGACP00000025459 ENSGACP00000025459 69293.ENSGACP00000025459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]