SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025482 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025482
Domain Number 1 Region: 890-1160
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.86e-69
Family Tandem AAA-ATPase domain 0.0000265
Further Details:      
 
Domain Number 2 Region: 642-888
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.82e-54
Family Tandem AAA-ATPase domain 0.0000575
Further Details:      
 
Domain Number 3 Region: 535-606
Classification Level Classification E-value
Superfamily Chromo domain-like 3.14e-16
Family Chromo domain 0.0053
Further Details:      
 
Domain Number 4 Region: 303-354
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 5.35e-16
Family PHD domain 0.0015
Further Details:      
 
Domain Number 5 Region: 389-454
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000000173
Family PHD domain 0.0001
Further Details:      
 
Domain Number 6 Region: 446-504
Classification Level Classification E-value
Superfamily Chromo domain-like 0.00000000000126
Family Chromo domain 0.02
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000025482
Domain Number - Region: 104-144
Classification Level Classification E-value
Superfamily HMG-box 0.000406
Family HMG-box 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025482   Gene: ENSGACG00000019275   Transcript: ENSGACT00000025532
Sequence length 1926
Comment pep:known_by_projection group:BROADS1:groupVII:3109900:3133382:1 gene:ENSGACG00000019275 transcript:ENSGACT00000025532 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KKKKDTKKKDKDGKPVKARKRKKIASDVERDSDRERDYGENSDSAPSDYGSVDGDRDSSQ
EETVKVENNPDPSQQPIEQKTSAQLAKDWGLEDVDHTFTEEDYRELTNYKAFSQFTRPMI
ARKNPKIPMSKMMTILGAKWRESAQQPLQGHRKAKRKEGKGVFSLTPFPPPPPCSRVTNE
SRDLFPLPGPGFKKRSKGSRVPEKKKAVAKAKKMAPIRIKLSPIGAKRKKSCSPLPRPGQ
SEDVEEDESEQEDSSVHSSSVRSDSSGRVKKNKRGRPAKKKKKTATCARPHPVAGEEEGD
GYETDHQDFCEVCQQGGEIILCDTCPRAYHLVCLEPELEKAPEGKWSCPHCEKEGIQWEA
KDEDFEDFEEDAEDRVISEVSALGAEEDDDDDHMEFCRVCKDGGELLCCDACTSSYHIHC
LNPPLPEIPNGEWLCPRCTCQLIKGRVQKILHWRWGDPPMKGRAEREFFVKLTGQSYWHC
TWITELQLEIFHSVMYRNYQRKTDMDEPPSLDYGSGGEDENGAGKSEKRRAKDPQYAKLD
DKYYKYGIKPEWMMIHRIINHSVDKKGTYHYLVKWRDLTYDQCTWERDDLDIPDFAIYKG
NYWRHRDAIMKEDPDKPRRMRSKNQEGEEESPASPVTDPTIKYDEQPDFVTSTGGTLHLY
QLEGLNWLRFSWAQGTDTILADEMGLGKTIQTIVFLYSLFKEGHTKGPFLVSAPLSTIIN
WEREFEMWAPDFYVVTYTGDKDSRAVIRENEFSFDEMAVKGGKKAFKLRREALIKFHVLL
TSYELVTIDQTALKSIDWACLVVDEAHRLKNNQSKFFRRLNDYKIDHKLLLTGTPLQNNL
EELFHLLNFLTPNRFNNLEGFLEEFADISKEDQIKKLHDLLGPHMLRRLKADVFKNMPSK
TELIVRVELSPMQKKYYKLILTKNFEALNSKGGGNQVSLLNIMMDLKKCCNHPYLFPVAS
IEAQKTPNGAYEGSALTKASGKLTLLQKMLRKLKDQGHRVLVFSQMTKMLDLLEDFLDHE
GYKYERIDGSVTGALRQEAIDRFNAPGACQFCFLLSTRAGGLGINLATADTVVIFDSDWN
PHNDIQAFSRAHRIGQANKVMIYRFVTRASVEERITEVAKRKMMLTHLVVRPGLGSKAGS
MSKQELDDILKFGTEELFKDELERMKNSSGDKVEDEGSVIHYDNVAIERLLDRSQDATDD
SDVQNMNEYLSSFKVAQYMVREEDKIEEVEREIIKQEENVDPDYWEKLLRHHYEQQQEDL
ASKLGKGKRNRKPVNYNDAAQEDQDNQSEYSVGSEEEDEDFDDRPEGRRHSRRQLRNEKD
KPLPPLLARVGGNLEVLGFNTRQRKAFLNAVMRWGMPSQDAFSSQWLVRDLRGKSEKEFK
AYVSLFMRHLCEPVSDGAETFADGVPREGLCRQPVLTRIGVMSLVKKKIQEFEHINGRWS
LPELKPEVAMDKSSSRASSPAVKTTTPTSEASYSNTPCTSEPATPAPFDKLERNGKEEDK
EESEGRADGERAKEKDEGSEEDGNGPADPEEVGLDRRPVKDAAQSASPGQRNKGQEDSDL
REDERKETSDAPAATTETEEETSRDVKEEKSAPAAAEATDAKAEEVKGERDAGKEARAAR
EDAPKGNARPPVERPRFMFNIADGGFTELHTLWQNEERAAISSGKMNEIWHRRHDFWLLA
GIVIHGYARWQDIQNDPQFAIVNEPFRSQANKGNFLEMKNKFLARRFKLLEQALVIEEQL
RRAAYLNMTQDPGHPAMALNARFTELECLAESHQHLSKESLAGNKPANAVLHKVLNQLEE
LLSDMKADVTRLPATLSRVPPIAGRLQMSERSILSRLASKGTETHTPPHIPAGPYATPHN
YGAPFTPAPPSALLMGGANYSHMPPGSFISAAALNGPPMSVKKEREAELLVNRREQRSGK
VICIDD
Download sequence
Identical sequences G3Q6H2
ENSGACP00000025482 ENSGACP00000025482 69293.ENSGACP00000025482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]