SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025537 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025537
Domain Number 1 Region: 534-702
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.22e-48
Family BCR-homology GTPase activation domain (BH-domain) 0.0000957
Further Details:      
 
Domain Number 2 Region: 3-196
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.84e-38
Family DBL homology domain (DH-domain) 0.00053
Further Details:      
 
Domain Number 3 Region: 209-278,332-365
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000081
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 4 Region: 403-497
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000208
Family PLC-like (P variant) 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025537   Gene: ENSGACG00000019319   Transcript: ENSGACT00000025587
Sequence length 751
Comment pep:novel group:BROADS1:groupVII:4050458:4060555:-1 gene:ENSGACG00000019319 transcript:ENSGACT00000025587 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLERRVALLKGLLEAEEVYLRELEALLMPMKALRASAGTSQPVLSSQQVQAVFYQVPEIR
DMHQSFYSGLKARLAEPGFDLMVGDLFLKMLNQIGLYGGFIGNYEKAVEVVRKCTNSDPR
FRTLAQSMMSANGANQTRTTYTLEALLYKPLDRVTKTTLVLHDLLKTTPEEHGDYASLQE
ALRLSRSFLSGVNERSQNKREVMLSHAVRRQLMRDGFVVDAAEGERHLRHLFLYTDLLLC
TRNKQATRGKQDQYRFCWYLPLAGLKLRWVADQELSPDARLRLHGIRTKMHLLRQQLQQH
ANGSKGLSAAARSRKKLEQMELMLLTHSPVHKLELHSPSGKSHTLLLSSLYELEEWRELI
EKLTKDNIETVPPDLLTLTSACVKLRMTQQPPLHSTRAVEDQKSLCGTVSVTVHSARGLQ
QPAFAYVCVEVDGYEFYDKQAKTHSSVQSLNPLWDQELCLQVDGAQVLRVICVSQSDRED
QSVLGKASVKLDATTLTKGWSRRTVHLGQVEVTLSLKYSPHPVEPPSATPQQNPVFCVPI
DALAQKEGVLVPHVVRCCVEEVERRGMDEVGLYRVSGDSSDVGALKNEFNSNLRDAVARM
RSADVNVVSGVLKLFFRELPEPLVPTEMFQSLARTLAIQDMDLRLVSMLSVLESCPPPNR
HTFLYLLHHLRRVSDKQDVNRMSLMNLATVFGPSLLRTPVVEHGLLGPSMDISQELVVQQ
VQVVFSYLQCNNLPEAWTSLPHDTDDEETTH
Download sequence
Identical sequences G3Q6M7
ENSGACP00000025537 ENSGACP00000025537 69293.ENSGACP00000025537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]