SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025555 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025555
Domain Number 1 Region: 410-530
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.14e-25
Family DEP domain 0.0000872
Further Details:      
 
Domain Number 2 Region: 2-80
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.96e-24
Family DIX domain 0.0032
Further Details:      
 
Domain Number 3 Region: 234-346
Classification Level Classification E-value
Superfamily PDZ domain-like 2.93e-23
Family PDZ domain 0.000027
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000025555
Domain Number - Region: 104-113
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0209
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025555   Gene: ENSGACG00000019331   Transcript: ENSGACT00000025605
Sequence length 721
Comment pep:known_by_projection group:BROADS1:groupVII:4104778:4115036:-1 gene:ENSGACG00000019331 transcript:ENSGACT00000025605 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAETKIIYHIDEEETPYLVKIPIAAENITLLDFKQVLNKPNYKFFFKSMDQDFGVVKEEI
SDDGAKLPCFNGRVVSWLVSSDATTAEPPVAVVPPVEATPQPSPPPPPLPPPPAERTGGI
GDSRPPSFHPNATGSVETLDDQTETESVVSFRRERPRHRESLEPHGPRMNGQTRLERHLA
GYESSSTVMSSELDTTSFCDSEDDDTMSRFSSATEQSTASRLLKRHRRRRKQRPPRLERA
SSFSSVTDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGR
IEPGDMLLQVNDINFENMSNDDAVRVLREIVHKPGPIILTVAKCWDPSPQGYFTLPRNEP
IRPIDPAAWVSHSVAMTGVYPPFPGSSSLSTITSSSSVTETERFDDFNLSLHSDMASVAK
AMASPESGLEVRDRMWLKITIPNAFLGSDVVEWLFHHIEGFQDRREARKYASNLLKAGFI
RHPVKKSSPSPTRNFLFSARTPYMANLSLNDNDGSSGASDQDTLAPLPLPGASPWPMMHT
FPYQPYPTHAFSSQPPPYHELTSYSYAPGSTGSQHREGSRSSGSTRSEGERRRSTKGPGS
TVGGGSGSESEYSTRSSLRRGHGSAAPSEHSHASSQRSHHHRLPQPPHMSPYPPGILPYN
PMMVMMVPQHPHPAMAAHGHPHTRDLGAVPPELTASRQSFHLAMGNPSEFFVDVMKYFSN
V
Download sequence
Identical sequences G3Q6P5
ENSGACP00000025555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]