SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025559 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025559
Domain Number 1 Region: 2-53
Classification Level Classification E-value
Superfamily PH domain-like 6.15e-19
Family Phosphotyrosine-binding domain (PTB) 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025559   Gene: ENSGACG00000019338   Transcript: ENSGACT00000025609
Sequence length 239
Comment pep:novel group:BROADS1:groupVII:4156789:4158262:-1 gene:ENSGACG00000019338 transcript:ENSGACT00000025609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNVRRCGHSENFFFVEVGRSAVTGPGEFWMQVDDSVVAQNMHETLLEAMKALSEEFRQRS
KSQSNSGPGGGATASNPISVPSRRHHPNPPPSQVGFNRRPRTEPPGGANGGAGGGSASAS
PTPRHSFPRSRTASDGGKVEEGMVGPTPLQGTCSRPSTNGSCSTTPILRSKSARSVPTSA
AKTPLGLTRSISTPAPSPAPSLSSSSGHGSEFGVVTSAGAATGSATYSRVPSRHASVSG
Download sequence
Identical sequences G3Q6P9
ENSGACP00000025559 ENSGACP00000025559 69293.ENSGACP00000025559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]