SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025569 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025569
Domain Number 1 Region: 4-289
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.79e-67
Family BAR domain 0.0015
Further Details:      
 
Domain Number 2 Region: 508-628
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.18e-24
Family Ankyrin repeat 0.00086
Further Details:      
 
Domain Number 3 Region: 240-357
Classification Level Classification E-value
Superfamily PH domain-like 9.18e-24
Family Pleckstrin-homology domain (PH domain) 0.0031
Further Details:      
 
Domain Number 4 Region: 379-446
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 0.00000000000000136
Family Pyk2-associated protein beta ARF-GAP domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025569   Gene: ENSGACG00000019339   Transcript: ENSGACT00000025619
Sequence length 676
Comment pep:known_by_projection group:BROADS1:groupVII:4179479:4192342:1 gene:ENSGACG00000019339 transcript:ENSGACT00000025619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVKLDFEECLKDSPRFRADIELVQSDVSELETRLEKLVKQCQAMLEAGRVYCHTSKSFV
SGLRDLGQHCSGDKTMEECLDKFSKKLSIILDAQGEVIETTQKSVKTKLQNFVKEDVRRF
KDVRKEFERSSECLEGALVRNAQAPRSKQHEVEEASNALLNARRAFRSEAMDYVLEINVI
EAKKKTDILMAMLSLMESQAQLFQHGHQSLSELDEYRRKLNEEHTQFVLNSAREKRDMEQ
RHAAIKKKDVSYDDSIMDFNADAANGIPMEGYLYKRASNAFKTWSRRWFSIQKNQLVYQK
KFKEQPTVVVEDLRLCTVKPSTENERRFCFEVVSPSNVGYWQAESEREQQAWISLIHTQT
RGFNGLLNFNRSPESPFLPKVRSLTLDSWEPELIKLMCELGNTVINRIYEARIDEITIKK
PHPSSPRGDKESWIRSKYVEKKFIQKLPETGRTALVRRSSGRRNRADAQDRPAQRPPLKP
KPGRATLPRLTDSDEEEEDLSGLHPGALLYRSAALQNFPVMADALAHGASVNWVNAAEES
STPLIQAVSANALAACEFLLQNGANVNQADSSGRGPLHHATILGHTGLVCLFLKRGADYN
AKDKNQKDPITIAVDTANADIVTLLRIAKMNKEMREMDGAFGQSGDETYHDIFRDFSHMA
SNNPEKLKRRSADPKT
Download sequence
Identical sequences G3Q6Q9
ENSGACP00000025569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]