SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025570 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025570
Domain Number 1 Region: 323-444
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.68e-25
Family Ankyrin repeat 0.00086
Further Details:      
 
Domain Number 2 Region: 57-172
Classification Level Classification E-value
Superfamily PH domain-like 7.35e-24
Family Pleckstrin-homology domain (PH domain) 0.0031
Further Details:      
 
Domain Number 3 Region: 194-261
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 8.63e-16
Family Pyk2-associated protein beta ARF-GAP domain 0.0032
Further Details:      
 
Domain Number 4 Region: 2-104
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000000000000022
Family BAR domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025570   Gene: ENSGACG00000019339   Transcript: ENSGACT00000025620
Sequence length 491
Comment pep:known_by_projection group:BROADS1:groupVII:4183985:4192018:1 gene:ENSGACG00000019339 transcript:ENSGACT00000025620 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDYVLEMLSLMESQAQLFQHGHQSLSELDEYRRKLNEEHTQFVLNSAREKRDMEQRHAAI
KKKDVSYDDSIMDFNADAANGIPMEGYLYKRASNAFKTWSRRWFSIQKNQLVYQKKFKEQ
PTVVVEDLRLCTVKPSTENERRFCFEVVSPSNVGYWQAESEREQQAWISLIHTQTRGFNG
LLNFNRSPESPFLPKVRSLTLDSWEPELIKLMCELGNTVINRIYEARIDEITIKKPHPSS
PRGDKESWIRSKYVEKKFIQKLPETGRTALVRRSSGRRNRADAQDRPAQRPPLKPKPGRA
TLPRLTDSDEEEEDLSGLHPGALLYRSAALQNFPVMADALAHGASVNWVNAAEESSTPLI
QAVSANALAACEFLLQNGANVNQADSSGRGPLHHATILGHTGLVCLFLKRGADYNAKDKN
QKDPITIAVDTANADIVTLLRIAKMNKEMREMDGAFGQSGDETYHDIFRDFSHMASNNPE
KLKRRSADPKT
Download sequence
Identical sequences G3Q6R0
ENSGACP00000025570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]