SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025571 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025571
Domain Number 1 Region: 101-312
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.09e-54
Family DBL homology domain (DH-domain) 0.0001
Further Details:      
 
Domain Number 2 Region: 332-445
Classification Level Classification E-value
Superfamily PH domain-like 4.21e-17
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025571   Gene: ENSGACG00000019345   Transcript: ENSGACT00000025621
Sequence length 555
Comment pep:known_by_projection group:BROADS1:groupIV:24449351:24454938:1 gene:ENSGACG00000019345 transcript:ENSGACT00000025621 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAYDELGSLVPIKRTLQVIDYQNQANKESEEPSTKRVRPLGRVTSLANLISPVKNGAVR
RFGQTIQASFRGDGKAPGVPQKPCSKPTAPTPPKRRNSMLWSETLDVHQKGTFSTKEIKR
QEAIFELSRGEQDLIEDLQLARKAYHDPMLKLSIMSEEELTHIFGNLDAYIPLHEDLLAQ
LAKATGPVGTVGQIGQIVMNWLPRLNAYKDYCSNQLAAKALLDQKKQDRRVQDFLQRCLE
SPFSRKLDLWSFLDIPRSRLVKYPLLLKEILRHTPPEHPDAASLEKAITIIQGVLSDIDT
KKGESECQYYIDKLEYLDDRQRDPLIERCKSLLCHGELRNKSGTKLHVFLFTELLVLTRP
VTRNERQCFQVYRQPIPVQDLVLEDLQDGDVRMGGSFRGAFSNADKAKNIFRVRSQDPSQ
AQSHTLQVNDVFHKQQWVNCLRSAISVHRPLSEPSTPAQNAHAKRRPSSVSAIVHMEEAD
ENHPQPPASQSAPSSPCNSATPSPTTTSPSSRSSSSTSSTASSSTSSPLSSPTSHKTKKD
KKSLYSLGKRKETMV
Download sequence
Identical sequences G3Q6R1
69293.ENSGACP00000025571 ENSGACP00000025571 ENSGACP00000025571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]