SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025585 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025585
Domain Number 1 Region: 9-228
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.31e-50
Family DBL homology domain (DH-domain) 0.00031
Further Details:      
 
Domain Number 2 Region: 219-358
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000548
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000025585
Domain Number - Region: 395-434
Classification Level Classification E-value
Superfamily SH3-domain 0.0204
Family SH3-domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025585   Gene: ENSGACG00000019358   Transcript: ENSGACT00000025635
Sequence length 452
Comment pep:known_by_projection group:BROADS1:groupVII:4221937:4226101:-1 gene:ENSGACG00000019358 transcript:ENSGACT00000025635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQSTLWQDLRAVQEAGVLEQLTPEQCKYQESMFEVLTSETSYLRSLRVLTEHFLSSRELE
ETMIIRDKKTLFSNILKIREVSERFLKDLEEHIFKELVFPDICDIINYHAQHHFPAYIDY
VRNQIYQDKTYSYLLKNNTQFATVITRLQESPQCQRLPFMSFLLLPFQRITRIKMLLENI
LRRTKEKTDEEQTALKALNSVSKIIDECNTEVGKMRQVEELYHVSKTLEFDKLKGVPIIS
QTRYLEKKGELQEMSRAGTIFNMRPKFNTVYLFLFNDLLIIAVKKGPERFVVLDYAHRSL
VQAHSTGESGVPVSSLEHCFCLTLLENHQGRMVERLLRAPSQSDMHRWMAAFPTSRKQKK
FIDFPLSRPESTEKLPRTITFDPPPPHLSSHFFLSGCYEGIRLSDGQRGWFPAANVMEIT
NEHVRRRNLRERYRVMQAATMVAGTKGNTLHK
Download sequence
Identical sequences G3Q6S5
ENSGACP00000025585 69293.ENSGACP00000025585 ENSGACP00000025585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]