SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025602 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025602
Domain Number 1 Region: 1091-1226,1283-1570
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.88e-110
Family Myotubularin-like phosphatases 0.00000278
Further Details:      
 
Domain Number 2 Region: 1625-1833
Classification Level Classification E-value
Superfamily PH domain-like 3.56e-28
Family Pleckstrin-homology domain (PH domain) 0.0000142
Further Details:      
 
Domain Number 3 Region: 861-1001
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000861
Family GRAM domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025602   Gene: ENSGACG00000019367   Transcript: ENSGACT00000025652
Sequence length 1836
Comment pep:known_by_projection group:BROADS1:groupIV:24590538:24618926:1 gene:ENSGACG00000019367 transcript:ENSGACT00000025652 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAAEGEGQGRILQRFPEKDWEDSPFPQGVELFCQPSGWQLVPERQPASFFVAVLTDINSD
RHYCACFTFWEGLDNPQLKKAEAGEVDEADDELTVVQPAQVFAPKSLVLVSRLDHTEVFR
NCLGLIYTVHVDGLTVPMETVVGNLLTCVIPIAGGSQRTITLGAGDRQVIQTPIDDALPV
SGSTVAQLFRQLGIVNVLCLFCAALTEHKILFLSSSYQRLTDACRGLLAIMFPLKYSFTY
VPILPGKLLEVLSTPTPFIIGVNSFFRSETQELLDVIIADLDGGTVTIPECVHISLLPEP
LLQQTQTLLSMVLDPELEVADHAFPPLSTQPSALKIQDKEIRGVFLWLFARLFQGYRWCL
HIIRIHPEPVIRFHKAAFLGQRSLTEDDFLMKVLDGMAFAGFVSERGPPYRAADLFDDLV
ANHVERIRQEETCPHKVMNHVKELAEQLFKNENPYPVVAMHKVQRPSENSQNSAQSQTPF
PMLDEVTVELFIDHAAAKLKTAPPVVKAELKSMVPSGPPLGDTVDRNGNVMANSARRLEV
VRNCITYIFENKMLEAKKLMPAVLRALKGRAARVCLTQELNQHVLQNRAVLDDQQFDYIV
RMMNCTLQDCSHIDEHGIAAALLPLVTAFCRKMGAGITQFAYSCVQDHMVWATMQFWEAM
FYSDVQNHIRALYLETEEGEQQNNHEEQDALGDGREISALELASEQSRLWPTLSKEMQTE
RVQKEESTVFSQAIHYANRMSYLLLPLDTSKNRLLRSTGLVDVESVSNSYVTNSIAGSMA
ESYDTESGFEDAESSDVANSVVRFINRFVDKVCNESGVTNEHLKALHTMIPDIVQMHIET
LDAVHRESKRLPPIQKPKLLRPTLLPGEELVMEGMRVHLIPDGREEAMGLMGGPPLLPAE
GAIFLTTYRLIFKGTPNDPLVGEQVVTRSFPIASLTKEKRISVSLPMDQFIQEGLQLRSC
TFQLMKIAFDEEVASDLAEVFRKHMHKLRYPPHVQGTFAFTVGQSGKMVVEHKTKDKNQS
LKTLSKNLVKSAKRTIGRQYVTRKKYSPPTWENRSSFQSELDEDEISVSEEVDQSSLTLS
STMRSSDRQTMSNVVERACCRDYQRLGLGTLSNSLTRSKNEPFRISTVNRMYTVCRSYPG
LLIVPQSIPDMTIQRICRCYRQNRFPVVCWRNPRTKGVLLRSAGLHAKGVVGFFKSPNTP
ASGPSQADSISLEQEKYLQAIISSMPSYSESSGRNTLSGFTSTHMSTSGKWGSIRGSGRL
SAYNPDVGTRLAGKESPQPNGGPSEALFLRQQKAYLYIIGDKAQLKGGKQDSFQQWEVVP
IEVCDVRQVKNSFKKLMKACVPSSSTSEPNMRFLRCLEESEWIALLHRVLQVSVLVVELL
DSGSSVMVSLEDGWDVTTQVVSLVQLLSDPYYRTFDGFRLLVEKEWLSFGHRFSHRGAQT
LGSQNSGFTPVFLQFLDCVHQIHLQFPMEFEFSQYYLKFLAYHYVSNRFRTFLLDSDYER
IELAGVLYEEKGERKSPQVCKSVWDYIDRLNEKTPVFYNYMFSLRTRRVLRPYTFNSNLK
VWDFYMEETLSEGPSYDWELRGWQERVAEETLDKADSGGPKSQRRIVWPCYDSLSKVVPD
AITKLLQDLQSLEAELGQTSEKWKDTWDKMKAAQRTECKLESKVTPASLLMASNLSHHRR
SQGVYLQESGVGSSINLAMDHEASATSTPVAGRPSTSTLYSQFQSTESENRSFEGILYKK
GALLKPWKPRWFVLDKTKHQLRYYESRQDKECKGVIELAEVESVIPGTPTMGAPKNIEEK
AFFDLKTTKRVYNFCAKDSMSAQQWMDSVQSCLSDA
Download sequence
Identical sequences G3Q6U2
ENSGACP00000025602 ENSGACP00000025602 69293.ENSGACP00000025602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]