SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025631 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025631
Domain Number 1 Region: 3-92
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.11e-31
Family Ubiquitin-related 0.0000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025631   Gene: ENSGACG00000019390   Transcript: ENSGACT00000025681
Sequence length 96
Comment pep:novel group:BROADS1:groupIX:17077320:17080225:1 gene:ENSGACG00000019390 transcript:ENSGACT00000025681 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISKRGEEGVKTENNEHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFR
FDGQPINETDTPSQLEMEDEDTIDVFQQQTGGSFLS
Download sequence
Identical sequences G3Q6X1
69293.ENSGACP00000025631 ENSGACP00000025631 ENSGACP00000025631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]