SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025635 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025635
Domain Number 1 Region: 13-128
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.83e-42
Family GABARAP-like 0.00000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025635   Gene: ENSGACG00000019396   Transcript: ENSGACT00000025685
Sequence length 136
Comment pep:known_by_projection group:BROADS1:groupVII:4349526:4352332:-1 gene:ENSGACG00000019396 transcript:ENSGACT00000025685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ERPTRCLSSRLKMKFQYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKK
YLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGLLYQEHHEEDFFLYIA
YSDESVYGSSQRFVLK
Download sequence
Identical sequences G3Q6X5
69293.ENSGACP00000025635 ENSGACP00000025635 ENSGACP00000025636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]