SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025636 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025636
Domain Number 1 Region: 1-116
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.27e-42
Family GABARAP-like 0.00000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025636   Gene: ENSGACG00000019396   Transcript: ENSGACT00000025686
Sequence length 122
Comment pep:known_by_projection group:BROADS1:groupVII:4349811:4352347:-1 gene:ENSGACG00000019396 transcript:ENSGACT00000025686 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFQYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQF
YFLIRKRIHLRAEDALFFFVNNVIPPTSATMGLLYQEHHEEDFFLYIAYSDESVYGSSQR
EI
Download sequence
Identical sequences A0A146ZVD0 A0A1A8FJQ7 A0A2I4C4Q4 C3KJC5 G3Q6X6 M4AMW7 Q6Y240
ENSXMAP00000015812 XP_005804839.1.87360 XP_008433627.1.1237 XP_010735475.1.61708 XP_010769391.1.77114 XP_011604965.1.43653 XP_012730221.1.37407 XP_013874972.1.33752 XP_014885175.1.100837 XP_015235027.1.42780 XP_017297280.1.84151 ENSGACP00000025636 ENSXMAP00000015812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]