SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025645 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025645
Domain Number 1 Region: 996-1063
Classification Level Classification E-value
Superfamily UBA-like 4.3e-16
Family UBA domain 0.00013
Further Details:      
 
Domain Number 2 Region: 1596-1658
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000206
Family Canonical RBD 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025645   Gene: ENSGACG00000019401   Transcript: ENSGACT00000025695
Sequence length 1776
Comment pep:known_by_projection group:BROADS1:groupIX:17270999:17292017:1 gene:ENSGACG00000019401 transcript:ENSGACT00000025695 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PASPTLPLSSSSSSSSGNGKRASQCQLPSASARYPPREVPPRFRQQEHKQLLKRGQPLPA
GALGALTLSWASSPGKTSTPSLIGEGGVKHPSKLPGFLFYSGSFAQYETSHWGDSLPVDS
SSGTNSWDKVISDRSNTEVWPAIGHSTQPCYPAAPECSLGSASSYTDTSAVTTTSGNSFM
SMATGAAGQQAHYSSLKANNNMMTGPGSANTCGSRGWGSDGKQDGMNGGRVGGPNNWGST
NFNLNLNPNANPSAWPVLGHEGGGSCSIGPNVVSNSPSLPPGINCNGNMGNGSLGGNDGG
GWVGMMSANENDQQHPSTNTSLSFKMEPSNLNNDGPNHTKQQQQAQEPMSPIHGITGWGG
QSPTESSQLNGDTTGSSVWGSGETKAADSPKESGWDSAPSGGHSAWGRQGSGGGSSGSGG
WGDWGKSSGGGDAPKGWESVDAGSSGSGQEQQLGSWGQQPRTAPASDASGDSNESQSGHR
DRSSSTDCTTVLPRHDLDPRVLSNTGWGQTPIRQHTIWEMEEANLIEGKSKGSSASTGGH
SSNVGPSSINGGTINPKIGPSQRPGSGEKNDSNEGSSSSGWRAPPPQPTQTGSGWGNLPQ
SHSKAPNGTTSGWGESVPPNGPRNGGTPSWGSEEKSSGWDHGPAKSQPTNWGEGPKSSHG
WGNSNGGSNGPSSGEWGETEVKNNGSSSSMWEGEGGNGGSGGWKESPRGGNRGGGWSKPA
PAVSNNSWGENPRANGTMQGSWGSAKPQGGGSMGSWGGPGTVKQNSSNWGNGSKQDQGMD
PTGWEEPSPPSIRRKMEIDDGTSTWGDPVSNKKTVNMWDRNNPNNNPGNSGPPPTHLQHH
GNNNGSSNNGSSHPGGGPQGRAPLANPGNPGWGELPNVPPKSEPTWGETAAPTASVDNGT
SAWGKSTGGVGGWGDGGHESSGPYGRPNGPTGSSACKPGPKPMQDGWGNGGEEMSMNTGQ
WDAEDGDMWNSPTSQESSSSCNSWGNGPKKGPSKGKMGKPDETWIMNRLIKQLTDMGFPR
DPAEEALKSNNMNLDQAMSALLEKKTDLDKRGMGMSDYSNGMNKPMVCRPSALSKDPCDR
TSFLDKPCIPSLTICVDVVQDGVLSDDAPPSPFLPSPSLKLPLANSSLPGQGLGQGNPGL
AMQNLNNRQIPSGMFGSSGAAQTRAMLQQQPPQPPVPPLSSSQPSLRAQVPQFLSPQVQA
QLLQFAAKNIGLNPALLTSPINPQQMTLLYQLQQLQMAYQRLQIQHQMMQAQRNVSGPIR
QQEQQMMALHQQRKQNIMYHRNSIYESILLKEEESPCHPVLHCSKRLFSGKSSHDSYGGP
HHTPGLADTLHTKEPRSSPKAYRYCLAGLNTNMNVNCMEVGGLSLKEPPQPQSRLSQWTH
SNSMDGLSGNSSNMENNHNKHGAISAASSLGPPGKPTHLDDSYSPYNLISSSESPTSPMV
SQESWGQGKSPNEKISNGTNINWPPEFCPGVPWKGLQNIDPENDPNMTPGSVPNGPTINT
NIHDVNRYLLRDRNGGKLSEMKSTWPQGPISQGQASLSHELWKVPQGPRSNAAPSRPPPG
LTNSKPSSTWGGNSLGLGQGWSGSYASEGTTWSTDSSNRTSSWLVLRNLTPQIDGSTLRT
LCMQHGPLVTFHLNLTQGNAVVRYSSKDEAAKAQKSLHISHLYCSVCLGNTTILAEFAGE
EVNRFFAQGQSLANNTTSWQANPGTNQNRMGGAAQSHSIGQWSCGGKSGGGDLLWGGMPH
YSSLWGPPGGDDGRVIGSPTPINTLLPGDLLSGESM
Download sequence
Identical sequences G3Q6Y5
ENSGACP00000025645 ENSGACP00000025645 69293.ENSGACP00000025645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]