SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025648 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025648
Domain Number 1 Region: 241-294
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000864
Family PHD domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025648   Gene: ENSGACG00000019402   Transcript: ENSGACT00000025698
Sequence length 297
Comment pep:known_by_projection group:BROADS1:groupVII:4367280:4368720:1 gene:ENSGACG00000019402 transcript:ENSGACT00000025698 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NASVSPHVSHKCLPPERKKRTVEDFNKFCSFVLAYAGYIPSPKEESSWSPTSSSSAHSSG
LSAGSSSTGNTWADGSSDIHTIHTFVRKARANKGKSIRRIHSDSTLLDKMRLKDSLYESQ
ASAKAERKKDKKLKRLSLGSGVTAADSGSSEGEKRARIKRSKNSKLPKPKKLKSATAQSE
TDSEAQHTHSEVRPAGEEPTEHGEGAPSLGKLQPDESIREAEMSSSEGETWIADEDIMVE
SGDDSWDLITCYCGKPFAGRPMIECNQCGIWVHLSCAKIKKSNVPDIFYCHKCRDLR
Download sequence
Identical sequences G3Q6Y8
ENSGACP00000025648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]