SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025666 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025666
Domain Number 1 Region: 7-121
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 4.45e-40
Family Pyk2-associated protein beta ARF-GAP domain 0.00063
Further Details:      
 
Domain Number 2 Region: 250-360
Classification Level Classification E-value
Superfamily PH domain-like 2.52e-20
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 3 Region: 135-220
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000904
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025666   Gene: ENSGACG00000019412   Transcript: ENSGACT00000025716
Sequence length 378
Comment pep:known_by_projection group:BROADS1:groupIX:17372989:17375813:-1 gene:ENSGACG00000019412 transcript:ENSGACT00000025716 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLDRNNKFLLNLVRQTGNNTCADCGIPEPDWASYTLGIFVCLNCSGIHRNLPDISKVK
SICLDIWDDALVEFMRQGGNSAAKALYEKCVPAFFYRPQQNDCFVLKDQWIRAKYERREF
TGENNQPSYCSDQFESTLWKKGKNKKQFLKRIFLLSRRDFTLRYFIKDDSKLPKAVISMK
DLNAVFQPEKINHANGLQISFANGKRTRNLFVYHEKGQVIVSLFNAIRATRLEYLQRKHP
TLRDNDLIPQITGRCVKEGYMEKTGPTQREPFKKRWFTLCSMNRKLLYFKNPLDASELGA
VFIGTASHSYAAAESGGPSSRGGRWHCGVTLQTPDREFVFMCEQQQEQKEWLEAFRKVIA
QPMTPEDYANEANMIRGK
Download sequence
Identical sequences G3Q706
69293.ENSGACP00000025666 ENSGACP00000025666 ENSGACP00000025666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]