SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025720 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025720
Domain Number 1 Region: 5-130
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000373
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025720   Gene: ENSGACG00000019457   Transcript: ENSGACT00000025770
Sequence length 161
Comment pep:known_by_projection group:BROADS1:groupIV:24954177:24955946:-1 gene:ENSGACG00000019457 transcript:ENSGACT00000025770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLENGMKVYKEGLLEKRSDGLLQLWKKKHCVLTEDSVLLLPPKQHDQPQQHHHHHHQQQQ
PHQGGGDTGKVKELHFANMKTVDCVERKGKYVYFTVVMAEGKEIDFRCPQDEGWNAAITL
QMVQYKNRQAILAVKSTRQKQQLLVVQMPGQKTVRSPPNVA
Download sequence
Identical sequences G3Q760
ENSGACP00000025720 69293.ENSGACP00000025720 ENSGACP00000025720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]