SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025725 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025725
Domain Number 1 Region: 324-713
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.7e-125
Family Oxysterol-binding protein 0.0000473
Further Details:      
 
Domain Number 2 Region: 75-196
Classification Level Classification E-value
Superfamily PH domain-like 3.01e-23
Family Pleckstrin-homology domain (PH domain) 0.00000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025725   Gene: ENSGACG00000019461   Transcript: ENSGACT00000025775
Sequence length 813
Comment pep:known_by_projection group:BROADS1:groupIV:24994302:25010245:-1 gene:ENSGACG00000019461 transcript:ENSGACT00000025775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GFERGKEDLLPLPLKEDSHSISKSKSETKLYNGSDKDVSASGGKLTKKESLKVQKKNYRE
EKKRATKELLSTITDPSVIVMADWLKRSRGTLKSWTKLWCVLKPGVLLIYKTHKNGQWVG
TVLLNACELIERPSKKDGFCFKLFHPLEQSIWAVKGPKGEGVGSITQPLPSSHLIFRAAS
ESDGRCWMDALELALKCSSLLKRTMIREGKEDMSTVATGGEHSINFYSLLRAHNIHGFQF
NDSDHLKDPDLYSDKSDREGEQDHEESDPEGLEKSEESDSDTSERQDDSYIDVDPNELLR
ETPYLEQSHEELGEAGEAAQTETVSEENKSLIWTLLKQVRPGMDLSKVVLPTFILEPRSF
LDKLSDYYYHADFLSEAAIEENAYNRMKKVVKWYISGFYKKPKGLKKPYNPIIGETYRCM
WLHQATNSKTFYIGEQVSHHPPVSAFYVSNRKDGFCLSGSILAKSKFYGNSLSAILDGEA
RLTFLNRGEDYVMNMPYAHCKGILYGTMTLELGGQITIACEKTGYSAQLEFKLKPFLGSS
DCVNQVCGKIKLGKEVLATLEGHWDSEIFINDKKTGTVDTFWNPTTELRQSRLTRCTVPP
EEQGELESERLWQHVTRAINNKDQTEATNEKFLLEEVQRKSARERKAKCEEWNPALFEQD
PVTGEWHYRYADTRPWDPLNDLIQFEKDGCIQTKVRHRTPMVTVPKRKHKSDKSKSRESG
CSSPEPDRQDSSGSERHKSKHTSRLRKKGADLCELQSAIESIKKTQEDINRNISVLRSRA
AGRVEGSSFLQQRDYIIIVFLILLQVLINYVFK
Download sequence
Identical sequences G3Q765
ENSGACP00000025725 ENSGACP00000025725 69293.ENSGACP00000025725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]