SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025750 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025750
Domain Number 1 Region: 41-88
Classification Level Classification E-value
Superfamily Cysteine-rich DNA binding domain, (DM domain) 7.72e-18
Family Cysteine-rich DNA binding domain, (DM domain) 0.0003
Further Details:      
 
Domain Number 2 Region: 245-292
Classification Level Classification E-value
Superfamily UBA-like 0.00000816
Family CUE domain 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025750   Gene: ENSGACG00000019482   Transcript: ENSGACT00000025800
Sequence length 412
Comment pep:known_by_projection group:BROADS1:groupVII:4940656:4942166:1 gene:ENSGACG00000019482 transcript:ENSGACT00000025800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESSVTPLGSPLGGLHVPPSLLRPPPLFFRGCNPVLERGYPRTPKCARCRNHGVVSALKG
HKRFCRWRDCVCAKCTLIAERQRVMAAQVALRRQQAQEESEARELRFMYPGPGSAGDTGI
RPASPVGPGGPAGQSSNPTAAGCDVFGAESQKEDISDNKLSKYSFYNGFMGRPLFAPDPA
RLPSPMDKKDLSPNKDITTSFSDDRASPSPVFDQHSDQVESPERSLSSSDPESGTESDKP
KDCRSQSPNRDPTDIMAKIFPHQKRDTLESMVRTCKGDIVRSIELVLSSKENQMDSDSLS
LSNHPSALWHSVGWPGVLGGLGNKSAFSPLHRDGLYGLNPRLGVSPLRLAYSSANGGMAG
FMSPYMTSGLMPVFPMRPPLDSYSFPGMMSYLQSKESLCSSAGLYTRHNSEK
Download sequence
Identical sequences G3Q790
ENSGACP00000025750 ENSGACP00000025750 69293.ENSGACP00000025750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]