SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025791 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025791
Domain Number 1 Region: 87-224
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.7e-38
Family Regulator of G-protein signaling, RGS 0.000000607
Further Details:      
 
Domain Number 2 Region: 776-856
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.96e-27
Family DIX domain 0.0000185
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025791   Gene: ENSGACG00000019513   Transcript: ENSGACT00000025842
Sequence length 856
Comment pep:known_by_projection group:BROADS1:groupIX:17973555:17980601:1 gene:ENSGACG00000019513 transcript:ENSGACT00000025842 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GVVAPLSVTTHFTEDAPRPPVPGKEGSDLDPPVQSANTRPNALSQSLGYPSSSSSKMGDL
SSYTPSSSSATPRRPDLDLGYEPEGSASPTPPYLKWAESLHSLLDDQEGIQLFRNFLCQE
GCADLLDFWFACSGFRKTSQEKRAKLAKAIYRKYIVDGSGIVSRQIKAATKSFIRDCVGR
PNPDPAMFEQAKTEIQGMMEENTYPLFLKSDLYLEYTRTGGESPKPNPSDQSPSSGTAKP
VPGYLPTLAEDEEWRCAEGVREAEEEKDEECGDTPADRLTQSLLMHTAPHRSATTRRRPD
AREYKHSPWKEPVNPYYANMGYARAPATSANDSEQQSMSSDADTMSLTDSSVDGIPPYRY
RKQHRKEMHESAKANGRVPLPHIPRTYRMPKDIHVEPERFAAELICRLETVLREREAQER
LEERLKRVRLEEEGDDADISVAPSVSSHSIPLPLPSTFTPLYGARYSETTANTAVATYGG
LVAMEDSQDDDPESILDEHVQRVMKTPGCQSPGATNSALGGGGRHSPPKSSRSPEGGTGP
PHCPPGRGHGVPPAGVKGELFCIHHHKQLYHHRGRDGQEEAGSRSQTNLMWNGDPAGQYA
GRSRNYADGAGASTLEGVGYSSKGSTLSRRGCKKASETLGKGEESGRGLEGQVPMEDLER
NHKILQWMMEGDRQRKTSHGGSTSSSRRTGPSSESPRPTSVERPGAVHPWVSAQLRNNVQ
PSHPFIQDPAMPPNPAPNPLTQLQQAKQSLDSHASVLTRLLLPFRHKSGKRQVCENMTVA
YYFCGEPIPYRTSVKGRVVTLGQFKELLTKKGHYRFYFKKVSDEFDCGVVFEEVRDDDAI
LPIFEEKIIGKVEKVD
Download sequence
Identical sequences G3Q7D1
ENSGACP00000025791 ENSGACP00000025791 69293.ENSGACP00000025791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]