SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025892 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025892
Domain Number 1 Region: 57-313,540-576
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.18e-95
Family Protein kinases, catalytic subunit 0.0000103
Further Details:      
 
Domain Number 2 Region: 665-773
Classification Level Classification E-value
Superfamily KA1-like 8.83e-45
Family Kinase associated domain 1, KA1 0.00000832
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000025892
Domain Number - Region: 341-374
Classification Level Classification E-value
Superfamily UBA-like 0.0194
Family UBA domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025892   Gene: ENSGACG00000019584   Transcript: ENSGACT00000025943
Sequence length 773
Comment pep:known_by_projection group:BROADS1:groupIX:18378943:18385919:-1 gene:ENSGACG00000019584 transcript:ENSGACT00000025943 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LWFRTSLLNLNHKHNNNYIVKTSDGLPDPPAPPTKSSSRHSLPPGRGTSVADEQPHVGNY
RLLKTIGKGNFAKVKLAKHTLTGREVAIKIIDKTQLNPTSLQKLFREVSVMKILNHPNIV
KLFEVIETEKTLYLVMEYASGAGEVFDYLVAHGRMKEKEARAKFRQIVSAVEYCHQKRIV
HRDLKAENLLLDTDMNIKIADFGFSNEFTLGSKLDTFCGSPPYAAPELFQGKKYDGPEVD
VWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKLLVLNPGKR
GSLQQIMKDRWMNVGYDEKELKTYNEPEQDFNDLKRIDQSELMGTMGFPREEVMKALDGQ
KYNEVTAIYLLLGRKAAECEAGDSLSSGNLVQRSRPSSDLNGSSQSPAHSRNSSANQKQR
RFSDHVAPSIPPPVCYTKRGHANSVESDRKDEAASPIRAPDRRRSATASGNITRRNTYVH
ERTSADRHSVAVSNGKDSSLPEVPAGSPSPSPGATVSSARPRHVKSMSASGHPMKSCLPP
IDDNVEYQSPRSSAQQPPPSSPSTFSVTSSSGTATPDRTRFPRGSSSRSTFHGAQLRDRR
SATYNGPPASPSLSTHTAASLAAPRRGTSASLIGKITSKFARRSDLPTSAKLYYRFKSSR
SLSGEPKEECRESKPRALRFTWSMKTTSSMEPGDIMKEIRRVLDANNCDYEQRERYSLFC
VHGDARQDSLVQWEMEVCKLPRLSLNGVRFKRISGTSIAFKNIASKVANELRL
Download sequence
Identical sequences G3Q7N2
ENSGACP00000025892 69293.ENSGACP00000025892 ENSGACP00000025892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]