SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026053 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026053
Domain Number 1 Region: 17-129
Classification Level Classification E-value
Superfamily Cap-Gly domain 1.31e-28
Family Cap-Gly domain 0.00055
Further Details:      
 
Domain Number 2 Region: 148-364
Classification Level Classification E-value
Superfamily L domain-like 1.59e-26
Family Ngr ectodomain-like 0.017
Further Details:      
 
Domain Number 3 Region: 436-524
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.66e-16
Family Ubiquitin-related 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026053   Gene: ENSGACG00000019717   Transcript: ENSGACT00000026104
Sequence length 525
Comment pep:known_by_projection group:BROADS1:groupIX:18937352:18941730:1 gene:ENSGACG00000019717 transcript:ENSGACT00000026104 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGANRTEPDGPAVPTDLLGRRVSCDGERASVLYVGPVPPTEGLWLGVEWDNPQRGKHDGA
HGGVQYFTCRRPGGGSFVRPAKVGLGVDFLAAVARVYQIDAEEVTSNDISFGPKKVKWGK
ITERSSYESLPSALLGSCEVNGPGADGEIRKTTPNVQVLDLSASLLSRWEDVSAIAQQLE
HLESLTLMNNRLRLPADVSAHRRSFRGLRVLALNGCELTWPQILQCAPMWPQLEELSVQD
NDITELQRRPEGVLQSLRSLNVSGNRLAQHTVPALAALLRLEYLNLSKTGLSDIRFDDAA
PGGQTDMFPALTKLNLEHNNISEWCVVNELAKLPRLTHLLCHSNQLVSSDGNPKTANQLL
IAKLGGLVSLNNCEIHHKERRGAEIDYIKMFGGEWLEAGGGRRPSAQFVSQHPRYLSLIA
KYGAPEEGELKKPEPFALKNQLLKITFVFPDAADREPIEKKLLASMLVQKVKGLLYRLLK
VPAADLKLTYTSPKKLGTEFEIDSDLKTLQFYSIEDGDQVLVRWS
Download sequence
Identical sequences G3Q839
ENSGACP00000026053 ENSGACP00000026053 69293.ENSGACP00000026053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]