SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026068 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026068
Domain Number 1 Region: 897-1019
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.87e-24
Family Ankyrin repeat 0.000000354
Further Details:      
 
Domain Number 2 Region: 32-113
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.34e-21
Family Ras-binding domain, RBD 0.012
Further Details:      
 
Domain Number 3 Region: 1021-1088
Classification Level Classification E-value
Superfamily SH3-domain 1.25e-16
Family SH3-domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026068   Gene: ENSGACG00000019730   Transcript: ENSGACT00000026119
Sequence length 1095
Comment pep:known_by_projection group:BROADS1:groupIX:19022037:19030700:-1 gene:ENSGACG00000019730 transcript:ENSGACT00000026119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PNGSFPPTDGSSIITVRRHHQFLHFVLFISLMFLTVYLSNNEQHFSEVPITPETLCRDVV
ELCKEPGEADCYLAEAWRGAEHVVGEGERMVEVLQRWGQQGGEVRYLLRHQRAPARDDLN
KSGSRAADQMIRRNQAKASVERCLENGVSDPRLDVTLSDLQDLATRQQQQINAQQQLLAS
KAKIKCYATVGWNDQNTCKPLAITSFRENANNQEAKLRRVRALRGQVEQKRLSNSKLVEE
IEQMTGLFQQKQRELLVAVSRVEELSDQLEELRSNRLEAPTPPPPIHLHHNTSSAAELER
LYKELQLRNKLNQDQSSRLQQQRDGLSKRNLEVASMDRRLAELRQRLWKKKAALQQKENL
PVAPDGVAPQHGAGSRVAAVGPYIQSSSTTSSQGPPVPARHEVLVKPAYPDGTATLPMPD
SSAKPPPRPVKPASGFSSSKISKLSDWSGSSPESGGGYSHASTLPRMSGLGSHRSDGKTL
TDKKALSGSDIPPPVPSRTNHITENLPRDNQASGKGLPKMAAPPPVPSKPKPFSSTGPPT
VSKPPYSTGTFPGKVRPVGGLLKAPGVLPSYCHTLPLPSKQESPPAAAVRPYTPELSEAP
PPVLQKPQRVAASSIYSMYTQQGKGYVGQRTLPRSQPRDKFPFTKIYGKPVLPASGGQQA
AATDAASSGSCATDGSEADTGCRGNGESVGAEAAERGNPRPLSPTKLLPFLSNPHRNPSD
ADLEALRRRLHHAPRPLKKRSSITEPEGPAGPNIQKLLYQKTTLAAMETIPMETVPAETP
SPARTTHVQPHEDGSGGADAMFRQPIAKPLEDKEEEEVCPPASARLDYFADEFPPYPPPP
YPTCEEAEQSEDSHNLQPPEVTGQVTVPPGKRSILRKADSERIDRSIRVKFNPLALLLDS
SLEGEYDLVQRVIYDVDDPSSPNDEGITALHNAVCAGHAEIVKFLVQFGVNANAADSDGW
TPLHCAASCNNVQVCKFLVESGAAVFATTYSDMQTAADKCEEMEDGYAQCSQFLYGVQEK
MGVMNRGVVYALWDYEPQRDDELGFSEGDCMTVLRRDDEAETEWWWARCGDSEGYIPRNL
LGLYLRIKPRQRSLA
Download sequence
Identical sequences G3Q854
ENSGACP00000026068 69293.ENSGACP00000026068 ENSGACP00000026068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]