SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026094 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026094
Domain Number 1 Region: 648-837
Classification Level Classification E-value
Superfamily Sec7 domain 5.76e-65
Family Sec7 domain 0.00000682
Further Details:      
 
Domain Number 2 Region: 847-990
Classification Level Classification E-value
Superfamily PH domain-like 5.99e-17
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000026094
Domain Number - Region: 556-567
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00994
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026094   Gene: ENSGACG00000019746   Transcript: ENSGACT00000026145
Sequence length 1029
Comment pep:known_by_projection group:BROADS1:groupIV:29700807:29758980:1 gene:ENSGACG00000019746 transcript:ENSGACT00000026145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESLLDNPMKAVLYLKELTTIVQNQQSLIQTQRQRIDELERKVEDLIGENRQLPESPQRQ
SAGAGQPPSAPGEQQSRGSSRPAGAAAAAASASAIPGLSAQPQQHPTPTAPSSHHHPQQL
QLVPTSPQSPKASQGSPDSAEEDKRSPCCKSLVPQTPTTLCRSVGLARKADNQTVLHQFC
CPAPEAPEGEASTACVPSCRPSCIRAEGTFSSSLCASCSAGSRSRRDSAAQNSSIGEEGK
GGEGEPQSGSKGRWGGEESQPAPHSVALEGAAQRAGSHSTTSDYELSLDLKGSKIEMLEH
KYGGHLISRRAACKIQTAFRQYQLSKNFEKIRNSLLESRLPRRISLRKARVQNPEGFSAE
RALAEGYNLTGIPLVRSPSLPATVGGTLTDLEDSFTEQVQSLAKSIDDALSNWSLKTMCS
LQEGGTYQFGADPFSAAAAAAAAGGGGGGGEGCAGGEPTLIQGPLDPSDLSRSASKLMMA
FRDVTVQFDSQKFCVSSSVMESSTVTLGSCVQQDGAPPTVTSTSTKANSFPVFTPAGLSQ
EPPPAPAELPAEPIDPPPPPQEPPPPPESEFEEGRANAAGELAPGGAPGETADNSSEQMS
SSSTSTEARSTSEASSKEALQAMILSLPRYQCENPASCKSPTLSTDVMRKRLYRIGLNLF
NVNPDKGLQFLISRGFIPDTPIGVAHFLLQRKGLSRQMIGEFLGNSKKPFNRDVLDCVVD
EMDFSGMELDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCMCNPDVVQQFHNPDTIFIL
AFAIILLNTDMYSPNIKPDRKMMLEDFIRNLRGVDDGADIPRDMVVGIYERIQLRELRSN
EDHVTYVSKVEQSIVGMKTVLSVPHRRLVCCSRLFEVTDVNKAQKQAAHQREVFLFNDLI
VILKLCPKKKSSAAYTFCKAMGLLGMQFHLFENEYYPHGITILSPFGSDKKQVLTFCAQS
AEELLKFVEDLKESISEVSEMEQIRIEWELEKQQGAKTHSVKNNGTQLELRGKLGSPSGS
KRPAEVGEE
Download sequence
Identical sequences G3Q880
ENSGACP00000026094 69293.ENSGACP00000026094 ENSGACP00000026094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]