SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026117 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026117
Domain Number 1 Region: 256-429,480-640
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 3.84e-132
Family Mammalian PLC 0.00000000197
Further Details:      
 
Domain Number 2 Region: 874-1127
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 1.31e-48
Family C-terminal domain of PLC-beta 0.0000619
Further Details:      
 
Domain Number 3 Region: 88-254
Classification Level Classification E-value
Superfamily EF-hand 5.53e-48
Family EF-hand modules in multidomain proteins 0.0000235
Further Details:      
 
Domain Number 4 Region: 1-86
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-24
Family Pleckstrin-homology domain (PH domain) 0.00038
Further Details:      
 
Domain Number 5 Region: 660-775
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.16e-24
Family PLC-like (P variant) 0.0000602
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026117   Gene: ENSGACG00000019760   Transcript: ENSGACT00000026168
Sequence length 1130
Comment pep:known_by_projection group:BROADS1:groupVII:7552878:7564274:1 gene:ENSGACG00000019760 transcript:ENSGACT00000026168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EVEILDINTIRDTRTGKYAKQPKDAKVRDVLGFGKGENVEGKLVTVVHGNDLVNISFLNF
QAMQKDAAKIWTDELFTLATNILSQNASRHTFLLKAYTKLKLQVNQDGKIPVKNVLKMFS
DKRRVETALEQCGLVNNKAEGIKPDDFTWEAFQRFLDSLCLRPEIQSIFEESGSKRKPFI
SLDQLMDFINRRQRDSRLNEVLYPPLKREQVRQIMEKYETNASQLERDQISLQAFSRYLE
GEENSIVPPERLDIIDDMNQPLSHYFINSSHNTYLTVGQLTGLSSVEIYRQVLLTGCRCV
ELDCWKGRPHDEEPYITHGFTMTTEIPFKEVIEAIAESAFKTSPYPLILSFENHVDSAKQ
QAKMAEYCRTIFGDALLIEPLEKYPLVPGQALPSPQELLGKILIKNKKKHQHHRPSSSGS
IRRRELEEQSSPNIDCPLMDSEGGQPLSNGEEKLVERMVKDFEPRKSLGELQGERRGRAD
WILNSGGEGESEEDEDDEPTAELKKPNSDEGTASSEVNATEEMSTLVNYIEPVKFKSFEV
ATERRKFFEMSSLVETKGMDTLKSSPIEFVEYNKNQLSRIYPKGTRVDSSNYMPQLFWNV
GCQMVALNFQTLDLPMQLNMGVFEYNGHSGYLLKPEFMRRTDKHFDPFTENIVDGIVANT
VKIKVLSGQFLIDKKVGVYVEVDIFGLPADTKRKYRTKTSNGNSLDPVWDDEMFVFNKVV
LPTLASLRIAVFEENGKFIGHRILPVSAIRPGYHYINLKNELNQPLLLPSLLVYAEAQDY
IPNEHQEYAEALTNPIKHISQLHKRETQLAALIEDNSEVRHLQPTRKHVPNQPKDGEKTK
MEWEDISQSRPQLPVPVLENAPDIIKLPAPGRDHLIATVLAEVQAQSIEELKQQKNYLKA
LKKQGKEIKEMRKKHLKKVWNLSKEQKSRNCQLQSDTQRRRTSRKSRERGWMDVWEPYDK
ELEKQTVQLREWQMQELLKLRQQLHSLEREKHQTHLQEALQKLKETTVECQAAQLKKLKE
TCEKEKKELQKILDRKRQNSICEAKTRDKDKAETELNEINRKHIQDSVSLIRGLEEAQTR
RQDKLMLRQREVLQQIDEELPLMQSKLERELEQEYQRLPEEICQHLQLEL
Download sequence
Identical sequences G3Q8A3
ENSGACP00000026117 ENSGACP00000026117 69293.ENSGACP00000026117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]