SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026218 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026218
Domain Number 1 Region: 7-268
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.94e-59
Family Ankyrin repeat 0.0000471
Further Details:      
 
Domain Number 2 Region: 1056-1225
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-48
Family Phosphotyrosine-binding domain (PTB) 0.0022
Further Details:      
 
Domain Number 3 Region: 906-969
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000432
Family SAM (sterile alpha motif) domain 0.0031
Further Details:      
 
Domain Number 4 Region: 832-901
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000648
Family SAM (sterile alpha motif) domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026218   Gene: ENSGACG00000019843   Transcript: ENSGACT00000026269
Sequence length 1271
Comment pep:known_by_projection group:BROADS1:groupIV:30754993:30864108:-1 gene:ENSGACG00000019843 transcript:ENSGACT00000026269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKEQELLEAARTGNVALVEKLLSGKKGILGSGSGSIPLPNLLSMWKGLNVNCTDSTGYT
PLHHASLNGHRDVVLKLLQFEASTSLADSKGCFPLHLAAWRGDVDIVRILLQHGSSHCRV
NQQNHERETALHCAAQYGHSEVVSVLLQELTDPTMRNSQQETPLDLAALYGRLQVVRMLV
SAHPNLMTSHTRRHTPLHLAARNGHRSAVQTLLEAGMDVNCVTENGSALHEAALCGKTDV
VRLLLDSEIDTNLRDSRGRTALEILREHPAPKSQQITALIQEYTMEEMEGRSISEEPVRK
CPVPAPRTSVPSPSASPSLRHKNDAVTSELSKLLHEIKKCRDRDYSFEELCHTISSHSVD
SFGSGRLSDEERPDRPNGTLTRAQVPVPPRRNRRPESSRQEEEAEKSCGPTGFWEALTPC
NGCRNLGFSSLSQDSKRSAEIVASPSLDVFLPADEDNPYESVTTAVTRKPCSLDINHRLN
SSPRNGPLSHVTASKGEPGNHGNCSTGPTPDCSPPSPDTALKNIERVIRPQPKQRTSLSS
ALDVQRPVNHSCEPSEVSSSLGYASFSTSPPASPPLSPNQEDSAGSNDDCQLTVDNRAQE
EPHPRGVCGLLHGSSPACETPDTPYHLYSPKPRKHACTDAQSGLVPSPDVSLVIAGGAPQ
IFSGSDPSPRRAADPAQKPQVVYRTIFHTRVNQEQARPADSSSSSCCASGQNGGVPEYRG
VQTGGGAPKGGAGCEERACTLGRMRSIPRSVLDLQRSKSLSKSDSNLVAVSPILKNASLQ
GPGSPSPGEGSGPGGRLERTPSFTAEWEEIDKIMSSIGAGICSGLDIKEDTSGSALPMQS
VAQWFDSIGLFQYKNHLFTNGFDTFQFMGSNVVEDQDLLEIGILNSAHRQRLLQAIRLLP
RVRPVGYDGNNPTSVAEWLESLELGDYTKSFLVNGYTSMELVKKIWEIELVNVLKISLIG
HRKRILASLGDRLLEETPQKPPRAISLREPGGNHTPPQLSPSVGQAAYTAGVPGGSLDVQ
HLIMQADARRRQRSNDNYFEDVPRSKLERQMAQGGDWCEPITLRPPNEATSSTPVQYWQH
HPEKLIFQSCDYEAYYLGSMLVKELRGTESTQDACAKMRSLWLFARSKKSTEQMKKVPTI
VLSVSYKGVKFIDATNKNIIAEHEIRNISCAAQDPEDLSTFAYITKDLKSSHHYCHVFTA
FDVNLAYEIILTLGQAFEVAYQLALQARKSGHGSSTLPESFDSKPSKPVPKPRVNIRKSV
SVASATSVPRE
Download sequence
Identical sequences G3Q8K4
ENSGACP00000026218 69293.ENSGACP00000026218 ENSGACP00000026218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]