SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026240 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026240
Domain Number 1 Region: 54-101,158-310
Classification Level Classification E-value
Superfamily PH domain-like 1.99e-37
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Domain Number 2 Region: 6-121
Classification Level Classification E-value
Superfamily EF-hand 0.00000208
Family Calbindin D9K 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026240   Gene: ENSGACG00000019860   Transcript: ENSGACT00000026291
Sequence length 555
Comment pep:novel group:BROADS1:groupIV:30935886:30940616:-1 gene:ENSGACG00000019860 transcript:ENSGACT00000026291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLKAELLKSIWYAFTSLDVEKCGKVSKSQLKVLSHNLYTVLNIPHNPVALEEHFQDDDD
GPVSNHGYMPYLNKYILDKVKEGMFDKEKFDDLCWMMTMKKNFKGLPQGALLSQRDCFKL
FCLFNLLSEDRYPLVMIPEEMEYLLKKISTAMNQEWDGKPLEEIMSQDATAWDGGDMSVW
SFLEHMAAGRLLRVTSAEAFSLALDEVFLEMYHNVLKRGYMWKKGHVRRNWTERWFVLKP
SSMAYYVSENLRDKKGEIQLDKSCIVEPIADREGKRCLFCVKTHNRTFEMSASDQRQKVE
WTQAIQTALRVQSEGKSSLHHELKLKRRVGRLQRARDGEGERQKGYGNRKHHTGEMRQES
AECRLLTHARELETRRREAEEKERRKQREVQLELERQLKEAETLRDSMQAEMQEKKKEAE
QQRKRIQELELTQRKLEAALNMEIHARLEEERARQELERLLEAEEAKKKQFQLLQEQQRA
LQCLSPIPEALDSSPEDPTPSALHSASQELQDLQASRQRSHQHLEELQEKLRYASQHVRH
WNVQLNRLMKPIGPG
Download sequence
Identical sequences G3Q8M6
69293.ENSGACP00000026240 ENSGACP00000026240 ENSGACP00000026240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]