SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026257 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026257
Domain Number 1 Region: 149-269
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-35
Family Phosphotyrosine-binding domain (PTB) 0.0000923
Further Details:      
 
Domain Number 2 Region: 5-125
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000198
Family Pleckstrin-homology domain (PH domain) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026257   Gene: ENSGACG00000019876   Transcript: ENSGACT00000026308
Sequence length 592
Comment pep:known_by_projection group:BROADS1:groupVII:7873702:7882009:1 gene:ENSGACG00000019876 transcript:ENSGACT00000026308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAHVKEGQLYVQHQKFGKKWKKNWFVLYPASQNGIARLEFFDSSGGGAAGGGSGSGSNE
KTRKLDKKIIRLSECISILPALTESCPKDNMAAICVETNDKTHVFAAEKNVAKDWMDTMC
DIAFQQGGGGSSAAADGDGGTQDLRMSENLIYYSREEVNEFWVSTQRTEASERCGLAGSY
WLKAEKDTLILKEPKTKRNILVWPYKLLRRYGRDRVMFSFEAGRRCDSGPGNFTFETKQG
NEIFSLVDQAIQSQKVLAEEHKLNLDPDCPASMLHIRTGGVTAGSGDSDGDSGGSKPGSA
DGVLGKRSLPEPPAMLGSAGGGLGTSKSSRGQTKALALADEHTSLYSEPADSVRLPPHGT
DCLYSDPVDSIKGQSQTSGASTLPVPAPRLRPVGEEASPGGIQGDHHNVGSNHRKPPDLY
SHLYDRISMELNHKTIALSLNEATGGGRGGNGPEHIYDEPEGCAKAGASLPAALGMSIYD
EARLEPHRRQENLHSPPQLGKPHPPGPRGPKPFTAPKPSRGAFGRKELLPHGKHAGPGSN
VNHNNNNVLGGGDGGREVYSKVSKQKPAFANLWQHQPLPRSPDLIYDNLGDV
Download sequence
Identical sequences G3Q8P3
69293.ENSGACP00000026257 ENSGACP00000026257 ENSGACP00000026257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]